KEGG   Thermocrinis ruber: THERU_00240Help
Entry
THERU_00240       CDS       T03001                                 

Definition
(GenBank) hypothetical protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
trd  Thermocrinis ruber
Brite
KEGG Orthology (KO) [BR:trd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:trd03400]
    THERU_00240
DNA repair and recombination proteins [BR:trd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     THERU_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 AAA_13 Baculo_PEP_C HPD ABC_tran
Motif
Other DBs
NCBI-ProteinID: AHE96728
UniProt: W0DIA4
LinkDB All DBs
Position
37686..40565
Genome map
AA seq 959 aa AA seqDB search
MRPIRLELENFTIFRGRHSVDFSGLRFFIIQGRTGAGKTSLIDAMCYALFGKVPRHGDKR
DLHEHLISKGTDHMRVFLEFSVRDKRYAIERAVRKGRGEVRFWEGNRLKNVKANELPELI
KRVLGVDYDTFTKVILLPQGQFDRFLKPERPQQRREILNKLLGVDTLIEKMAELIRETKR
QIENRLESITASLRELSFATKEELERVNKEITLLEKDLNLLEEEKKKLQERLNVASNRDR
LQEELTECQRQLTELLEKAEKMEQLERDLQVMEELSSYAPYVESFKSLSQREEQEIKEIK
SLREKLAKLSHQREQFQIQLEKYRQEWERLGEYDVQIEQLTKELERLKNALEKHRERNQK
LKELENAEEEIKTLEEDIKNLTERIDRGENYIKELREKIEDLEEKQRRLLELNPIKIKLD
EVRRERESLELLKEEKELLEEQLEKIREDIKEKESSLIRFHVEHIRAHLKEGDLCPVCGN
VITQLPPTEPSENFETIKRELDKLKALESEKLEKKARIESKLSALEEKERELRQLLNEWE
EEERFEEEYRELQRSQAELEECRRKLKQAEEKLKNLKEELSTKRERLSTQEGRREKLQTL
IKEIEEHLAIEGFWEVKEQDIREKQVQLKTLKDRRDMIRNNYTTISEQLRNVELEEKRVQ
TALLERERNIQNLKEEKERVAKNLEPAIKKFGLGTVQELEKLIKPKEYIERLKQELEDYK
RNVALLKEKEQRLKEELKNFEGVEPTQEIKAKMQQVEEEHKNKSVQLGHLREQKTRIEEG
LKRREELLKDQEELQRKEGIYRILERDFRADRLQEFLSQIMLQKIIARANFYLQKFTSGA
YEYDLEGSEILIIDRISGHKRSVSTLSGGETFLASLSLAFGVSDIISKNAPIESLFIDEG
FGSLDRETREELSQFFEMIKLNANRMVGIISHLEDLAEKFDQRIEVVRRGDRSFVNVIV
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgagacccatcaggcttgaactggaaaactttaccatctttaggggaaggcatagcgta
gacttctcagggctcagattttttatcattcagggtaggacaggggcaggaaagacaagt
ttaatagacgccatgtgctatgccctctttggaaaggtgccaaggcacggagataaaaga
gacctccatgagcacctgatctcaaaaggaacagaccatatgagggtattcttggagttc
tccgtcagggacaaaaggtatgccatcgagagggctgtgaggaagggaaggggtgaggta
agattctgggaagggaacaggcttaagaatgtaaaggcaaacgagcttcctgagctgatc
aaaagggtcttaggagttgattatgatacctttaccaaggttatacttttgccacaggga
cagtttgacaggtttttaaagcccgaaaggccacagcaaaggagagaaattctaaacaag
ctcttgggtgtagatacccttattgagaaaatggcggagctgataagggagacaaaaaga
cagattgaaaaccgcttggagagtataaccgcatccttgcgtgagctcagctttgccaca
aaagaggagcttgaaagggtaaacaaagagatcacccttttggagaaggaccttaacctt
ttggaagaagagaaaaagaagctacaagaaaggctcaatgttgcatccaacagggaccgc
cttcaagaagagctaacagagtgccaaagacagctaacagaacttcttgaaaaggcagag
aagatggaacagcttgagagggatcttcaggtaatggaagagctaagctcctatgctccc
tacgtggaaagttttaagagtctttcccaaagggaggagcaggagataaaggaaataaag
agtttaagggaaaagcttgccaaactttcccatcagagggagcagttccaaatacagttg
gaaaaataccgtcaagagtgggaaagattgggcgagtacgatgtgcaaatagaacaacta
acaaaggagttagaaaggctaaagaacgcccttgaaaaacacagagaaagaaaccaaaag
ttaaaggagttggaaaacgcagaagaagagataaagactttggaggaagatatcaaaaat
ctaactgagagaatagacaggggcgaaaactacataaaggagctaagggagaagatagaa
gatttagaggaaaagcaaagaagacttttggagctcaatcccataaagataaagcttgat
gaggtaaggagggaaagggaaagcttggaacttcttaaagaagagaaggagctcttggaa
gaacagctagaaaaaatcagagaagacataaaagagaaggaaagctcccttattcgcttt
catgtggaacacataagggcacacctaaaggagggagacctttgcccagtgtgtggcaac
gtaattacccagctacctcccaccgagccctctgagaactttgaaaccatcaaaagggaa
ctggataagcttaaagcccttgaatctgagaaacttgagaaaaaggcaagaatagagagc
aagctttctgccctggaggaaaaggagagggagctaaggcaactgctaaatgaatgggag
gaagaagagaggtttgaagaggagtatagggaactacaaaggtcccaagctgaactggag
gaatgcagaagaaagctaaaacaggcagaggaaaaacttaagaatttaaaggaagagcta
agcaccaaaagagaaaggctatccacccaggagggtagaagggaaaagttgcaaacctta
ataaaagagatagaggagcatttagcaatagaaggcttttgggaagttaaggaacaggac
ataagggaaaaacaggtccagttaaaaaccctcaaagacagaagggatatgataagaaac
aactataccactatctccgaacagttaagaaatgtagaactggaggagaaaagggtccaa
accgcccttttagaaagagaaaggaatatacaaaacctaaaagaggaaaaggaaagggtt
gccaaaaacttggagccggccataaagaagtttgggctcggaacggtgcaagagctggaa
aaactcataaaacccaaggaatacatagaaaggctaaagcaagagttggaagattacaaa
aggaacgttgccctgttgaaagaaaaagaacaaaggctaaaggaagaactgaagaacttt
gagggagtagaacctacccaagagataaaggctaagatgcagcaggtggaagaagaacac
aaaaacaaaagtgttcagcttggacatttaagggaacaaaaaacgcgcatagaggaaggg
ttaaaaaggagggaagagcttttgaaggatcaagaggagcttcagaggaaggagggtata
tacagaatccttgaaagggactttagggcagacaggcttcaggaatttttaagtcagatc
atgctccaaaagatcatagcaagggccaacttctacctgcaaaaattcacatctggcgcc
tacgagtatgacttagagggttcagaaatcctaataatagacaggatatccggacacaaa
agaagcgtaagcaccttgagtggtggagagacctttttggcaagcctctctttagccttt
ggtgtaagcgacataatatccaagaacgcacccatagagagccttttcattgatgagggc
tttggtagccttgacagggaaacgagggaagagctatctcagttttttgagatgataaag
ctcaatgccaacaggatggttgggatcataagccatctggaggatctggcagagaagttt
gaccaacgcatagaagtggtaaggcgaggagataggtcctttgtgaacgtgatagtgtga

DBGET integrated database retrieval system