KEGG   Thermocrinis ruber: THERU_03440Help
Entry
THERU_03440       CDS       T03001                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
trd  Thermocrinis ruber
Brite
KEGG Orthology (KO) [BR:trd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    THERU_03440
Enzymes [BR:trd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     THERU_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA NAD_binding_9 HI0933_like FAD_oxidored DAO FAD_binding_2 Thi4 NAD_binding_8 FAD_binding_3 NAD_binding_7 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AHE95890
UniProt: W0DG81
LinkDB All DBs
Position
624280..625209
Genome map
AA seq 309 aa AA seqDB search
MKQLAIIGGGPAGISASIYAARKKMDFVLITKEVGGQVIKAGNIENYLGYAMVDGIILVE
KMMEHMRKLEVEPILDEVVDVERLSEGFEVRTASGQSFKTKTVLFCTGSEHRRLNVPGEK
EYTGRGISYCYTCDAPFFKNKKVAVVGGGNSGFEAAEQLLNYASTIYLLEISDQFRADEV
LREKVLGNEKVIPLLRHRVVSAEGDGMFLKAIVVEDLEKGKTYRLDVEGLFVEIGLEPNT
KLAQKLGVLLNSRGEIIIDCNNRTSERGVYAAGDCTNIFAKQIITAAGDGAKALLSIYHD
LTYGVSSWI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactggccataataggcggaggtcctgcgggcatttctgcttcaatatacgca
gcacggaagaagatggacttcgtactgatcaccaaagaggtgggagggcaggtgataaag
gcgggcaacattgaaaactacttgggctacgctatggtagatggcatcatccttgtggaa
aagatgatggagcacatgagaaagttggaagtggaacccatattggacgaggtggtggat
gtggaaaggctatccgagggctttgaagtgagaactgcgtctggacaatctttcaagaca
aaaaccgtactcttttgcacgggttcagagcacagaaggctaaacgtgcccggagagaag
gaatacaccggtaggggtatatcctactgctacacctgtgatgcgcccttcttcaagaac
aaaaaggtggctgtggtaggtggagggaactcgggctttgaggcggcagagcagttgtta
aattatgcaagtaccatctaccttttggagatctccgaccaattcagggcagatgaggtg
ctgagggaaaaggtgttagggaacgagaaggtcattcctctcctcaggcacagggttgtg
tctgcggaaggggatggtatgtttctcaaggctattgtggtggaagacttggaaaagggc
aaaacttaccggttggatgtggaagggctctttgtggaaatagggctggagcctaacacc
aagctggctcaaaagctgggagtattacttaacagtaggggcgagatcataatagactgc
aacaacagaacctccgagaggggtgtctatgcggcgggagattgcacaaacatatttgcg
aaacagatcattaccgccgcaggggatggggcaaaggctctactttctatataccacgac
cttacctacggcgtgagctcatggatatag

DBGET integrated database retrieval system