KEGG   Trichoderma reesei: TRIREDRAFT_104390Help
Entry
TRIREDRAFT_104390 CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tre  Trichoderma reesei
Pathway
tre00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TRIREDRAFT_104390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tre02000]
    TRIREDRAFT_104390
Enzymes [BR:tre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TRIREDRAFT_104390
Transporters [BR:tre02000]
 Other Transporters
  Pores ion channels [TC:1]
   TRIREDRAFT_104390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 18480835
NCBI-ProteinID: XP_006962724
JGI: Trire2_104390
UniProt: G0RC94
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MILKPIKLYWRNHVPNPSKVLIILEELSLPYETSWVELDGLKKQPYTDVNPNGRVPAIED
PNSGITLWESGAIVQYLIDTYDKDNKISYSSFPEKYLTVQWAYFQASGQGPYFGQAAWFN
LFHEGAYGESPESAKIRYGNEVKRIAGVLDGVLAKSEWLVGDKCTYADLAFTMWNMQIAF
FMGSRTGEHAWDPDAFPHFTRWQNACLARASVKKVVSVLGEQEVKSG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgattctcaagccgatcaaactgtactggcgaaaccatgtccccaacccttccaaggtc
ctcatcattctcgaggagctgagcctcccttacgagacttcatgggttgagcttgatggc
ctcaagaagcagccctacaccgatgtcaaccccaacggccgcgttccggccatcgaggac
cccaacagcggcattacgctctgggagtctggcgccattgtccagtacttgatcgacacg
tacgacaaggacaacaagatctcgtacagcagcttccccgaaaagtacctcacggtgcag
tgggcgtactttcaagcctctggccagggcccttactttggccaagccgcatggttcaac
ctcttccatgaaggcgcatacggcgagtcccccgagtcggccaagatccgctacggcaac
gaggtcaagcgcatcgccggcgtcctcgacggcgtgctggccaagtcggagtggctcgtg
ggcgacaagtgcacgtacgccgacctggcctttaccatgtggaacatgcagattgccttc
ttcatgggcagccgcacgggggagcacgcgtgggacccggatgcgtttccgcatttcacg
aggtggcagaatgcgtgcttggccagggccagtgtcaagaaggttgtgagtgtgttgggc
gagcaggaggttaagagcggctga

DBGET integrated database retrieval system