KEGG   Trichoderma reesei: TRIREDRAFT_111216Help
Entry
TRIREDRAFT_111216 CDS       T02991                                 

Definition
(RefSeq) histone H3 methyltransferase
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tre  Trichoderma reesei
Pathway
tre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    TRIREDRAFT_111216
Enzymes [BR:tre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TRIREDRAFT_111216
Chromosome and associated proteins [BR:tre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     TRIREDRAFT_111216
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    TRIREDRAFT_111216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 18482291
NCBI-ProteinID: XP_006968782
JGI: Trire2_111216
UniProt: G0RU80
LinkDB All DBs
Position
Unknown
AA seq 302 aa AA seqDB search
MEAVTRQHFFFHDQPLRAFPAHKTIPVTIVNEVDQAVIPPNFRFVDRMVLRRGVEPAEDS
FRSGCSCESDDACQYTGCLTKRKAYAYHSHGAKAGLLRSKMLNSKEPLYECHAGCSCSMS
CPNRVVERGRTVPLQIFRTPDRGWGVHAQAAIKKGQFVDRYYGEIITSAEADRRRTAAAF
SQRKDVYLFALDKFTDPDSLDARLRGPPLEVDGEFQSGPTRFINHSCEPNLRIFARVGDH
ADKHIHDLALFAIRDIPRGEELTFDYVDGVMTGDLAGMEEQEAHGEMAKCLCGSRKCRGY
LW
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtcacgagacagcactttttcttccacgaccagccgctccgcgcctttccc
gcgcacaagaccatccccgtcaccatcgtcaacgaggtcgaccaggccgtcatcccgccc
aacttccgcttcgtcgaccgcatggtcctgcgccgcggcgtcgagcccgctgaggatagc
ttccgcagcggctgctcgtgcgagtccgacgacgcgtgccagtacacgggctgcctgacg
aagagaaaggcgtacgcgtatcactcgcacggggccaaggcgggcctgctgcgctccaag
atgctcaactccaaggagccgctgtacgaatgccatgccggctgctcgtgctccatgagc
tgccccaaccgggttgtcgagcgagggcgaaccgtgccgctgcagatattccgcaccccc
gataggggctggggagtacacgcccaggcggccatcaaaaagggccagttcgtcgaccgc
tactacggcgaaatcatcacctcggccgaggccgaccgccggcgcaccgccgccgccttc
tcccagcgcaaggacgtctacctcttcgccctcgacaagttcaccgacccggactcgctg
gacgcgcgcctccggggcccgccgctcgaggtcgacggcgagttccagtcgggcccgacg
cgcttcatcaaccactcgtgcgagcccaacctgcgcatctttgcgcgcgtcggcgaccac
gccgacaagcacattcacgacctggcgctctttgccatcagggacattcccaggggggag
gagctgacgtttgattacgtcgacggggtgatgacgggggacttggccgggatggaggag
caggaggcgcatggcgagatggccaagtgtttgtgcgggagccgcaagtgcaggggatat
ctgtggtga

DBGET integrated database retrieval system