KEGG   Trichoderma reesei QM6a: TRIREDRAFT_121019Help
Entry
TRIREDRAFT_121019 CDS       T02991                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00020  Citrate cycle (TCA cycle)
tre00190  Oxidative phosphorylation
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
tre01130  Biosynthesis of antibiotics
tre01200  Carbon metabolism
Module
tre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tre_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRIREDRAFT_121019
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TRIREDRAFT_121019
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TRIREDRAFT_121019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 18483029
NCBI-ProteinID: XP_006963729
JGI: Trire2_121019
UniProt: G0RF65
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MASSMALRKLASGPSFSRFARNQLRTFSSTRPAARVIANGPLRAKEASPFVSSKYPVIDH
EYDALVVGAGGAGLRATMGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTEDGKIYQRAFGGQSQKY
GKGGQAYRCCAAADRTGHALLHTLYGQSLRYNANYFIEYFAIDLIMQDGECRGVLAYNQE
DGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPE
KDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTGE
VLTVDEKGQDKVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGRAVAHTIRDNFQPGT
KLKPLPADAGAEHIEVLDKIRTSDGPKSTAEIRLAMQKTMQTEVSVFRTQESLDEGVRRM
KEVDQTFADVGIKDRSMIWNSDLVETLELRNLLTCAVQTATAAAARKESRGAHAREDYPE
RDDENWMKHTLSFQKQPHGKVDLTYRRVIATTLDEAECKPVPPFKRVY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctctatggcattgaggaagttggcctctggcccttcgttctcgcgattcgcg
cggaatcaactccgaaccttttcatctactcgaccggcagctcgtgttattgcaaacgga
cctttgagagcaaaggaagcttctccttttgttagctccaagtatcccgtcattgaccat
gagtacgacgcgctcgttgtcggagctggtggtgcgggtctgagagcaacaatgggtctg
gctgaagctggcttcaagactgcctgcatttccaagctcttccccacaagaagtcacacg
gtagctgctcagggcggtatcaacgctgccctgggaaacatgcacgaggacgactggaga
tggcacatgtacgacaccgtcaagggttccgactggctgggcgaccaggatgctatccac
tacatgacccgcgaggctcctgcttccatcatcgagctggagcactacggctgcccgttc
tcccgtactgaagacggcaagatctaccagcgagcctttggtggtcaatcccagaagtat
ggcaagggtggccaggcctaccgatgctgtgctgctgccgaccgaaccggccacgccctg
ctgcacactctctacggccagtccctccgttacaacgccaactacttcatcgagtacttc
gccatcgacctgattatgcaggatggcgagtgccgtggtgtcctcgcctacaaccaggag
gatggcaccctgcaccgattccttgccaacaacaccgtcttggctactggtggctacgga
cgtgcttacttcagctgcacgtctgcccacacctgtaccggtgatggtatggccatggtt
gcccgagccggtctccccaaccaggatctcgagttcgttcagttccaccctactggtatc
tacggtgctggctgcctgatcaccgagggtgctcgtggcgagggtggttacctgctcaac
tccgagggtgagcgcttcatggagcgatatgcccccactgccaaggatctggcctcccga
gacgtcgtctctcgatcaatgacaatggagattcgcgaaggccgtggtgttggtcccgag
aaggaccacatctacctccagctcagccatctgcctgcggagattctcgccgagcgtctt
cccggcatctccgagactgccggcattttcgccggtgtcgatgtcaccaagcagcccatc
cccgtcctgcccaccgtccactacaacatgggtggtatccctactcgctacactggtgag
gttcttactgttgacgagaagggtcaggacaaggttgtccccggcctgttcgcctgtggt
gaggctgcttcagtgtctgtccacggtgccaaccgactgggtgccaactccctgctggac
ctggtcgtcttcggccgtgccgttgcccacaccatccgtgacaacttccagcccggtacc
aagctgaagccccttcctgctgatgccggcgctgagcacattgaggtcctcgacaagatc
cgaacgtctgacggccccaagagcactgccgagatccgcctggccatgcagaagaccatg
cagaccgaggtcagcgttttccgaacccaggagagcttggacgagggtgtccgccggatg
aaggaggttgaccagacctttgcggacgttggcatcaaggaccgcagcatgatctggaac
tctgatctcgttgagactcttgagctgcgaaacctgctcacttgcgccgttcaaaccgcc
accgccgccgccgcccgaaaggagtctcgtggcgctcacgcccgcgaagattaccccgag
cgtgacgatgagaactggatgaagcacaccctcagcttccagaagcagccccacggcaag
gtcgacttgacataccgcagggttatcgccaccactctggacgaggcggagtgcaagcct
gtgccccccttcaagcgtgtgtattaa

DBGET integrated database retrieval system