KEGG   Trichoderma reesei: TRIREDRAFT_122350Help
Entry
TRIREDRAFT_122350 CDS       T02991                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tre  Trichoderma reesei
Pathway
tre00250  Alanine, aspartate and glutamate metabolism
tre00410  beta-Alanine metabolism
tre00430  Taurine and hypotaurine metabolism
tre00650  Butanoate metabolism
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
Module
tre_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TRIREDRAFT_122350
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRIREDRAFT_122350
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRIREDRAFT_122350
   00430 Taurine and hypotaurine metabolism
    TRIREDRAFT_122350
Enzymes [BR:tre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TRIREDRAFT_122350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 18483382
NCBI-ProteinID: XP_006966189
JGI: Trire2_122350
UniProt: G0RLK7
LinkDB All DBs
Position
Unknown
AA seq 547 aa AA seqDB search
MVHLTAISRSGSVTPSEEPTAAQAAAPAGASGPTLSVNDRPSLHKSLSQVKLSSYADEFT
TSVYGSQFAGQDLPKHSMPAGAMPRDVAYHMIKDHLSLDNNPKLNLASFVTTYMEDEAEK
LMTEAFSKNFIDYEEYPQSADIQNRCVNMIGDLFHAPHGGDSIGTSCIGSSEAIMLAVLA
MKRRWKLRRQAEGKPTDRPNIIMSSAVQVCWEKAARYFEVEEKYVYCTETRYTIDPDEAV
ALIDENTIGIAAILGTTYTGHYEDVKGINDLLVEKGLDVPIHVDAASGGFVAPFVLPDLE
WDFRLPQVVSINVSGHKYGLVYPGVGWVVWRSHEYLPQDLIFNINYLGAEQSSFTLNFSK
GASQVIGQYYQFIRLGRRGYESIMSNLTRTADYLTDVLEKSLGFVIMSERQGQGLPLVAF
RFKTAQEGGKQRHYDEFALAHHLRSRGWVVPAYTMAPHTNEMKMLRVVVREDFSKSRCDL
LIHDIKLCVAMLENMDAETVRKQEEFIKEHIATHGKTKHQHRHHASKHYTGEEHSLQGKT
GKTHAIC
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtccacctcaccgcaatcagccgctccggctccgtcacgccctccgaggagccgaca
gcagcgcaagcagcagctcccgccggcgcctcgggcccaaccctctccgtcaacgaccgg
ccgagcctgcacaagagcctctcgcaggtcaagctgtcgagctacgccgacgagttcacc
acgagcgtctacggctcgcagtttgcgggccaggacctgcccaagcacagcatgcccgcg
ggcgcgatgccgcgggacgttgcctaccacatgattaaggaccatttgagtctggacaac
aacccgaagctcaacttggcgtctttcgtcacgacttacatggaagacgaagccgaaaag
ctcatgacagaagccttttccaaaaacttcatcgactacgaggaatacccgcagtcggcc
gacatccagaaccgctgcgtcaacatgatcggcgacctgttccacgcgccccacggcggc
gacagcatcggcacctcgtgcatcggctcgtccgaggccatcatgctggccgtcctggcc
atgaagcgccgctggaagctgcgccgccaggccgagggcaagcccaccgaccggcccaac
atcatcatgtcgtccgccgtccaggtctgctgggaaaaggcggcgcgctacttcgaggtc
gaggagaagtacgtctactgcaccgagacgcggtacaccatcgatcccgacgaggcggtt
gccctcattgacgagaacacgattggcatcgcggccatcttgggcactacctacacgggc
cactacgaggacgtcaagggcatcaacgacttgcttgtcgaaaaggggctggatgtgccg
atccacgtcgatgccgccagcggtggctttgttgcgccgtttgtgctgccggacctggag
tgggatttcagactgcctcaggtggtttccatcaacgtctccggccacaagtacggcctc
gtctaccccggcgtcggctgggtcgtctggcgctcgcacgagtacctcccccaggacctc
atcttcaacatcaactacctcggcgccgagcagtcctccttcaccctcaacttctcaaag
ggcgcctcccaggtcatcggccagtactaccagttcatccgcctcggccgccgcggctac
gagtccatcatgagcaacctcacccgcaccgccgactacctgaccgacgtgctcgagaag
tcgctcggcttcgtcatcatgtccgagcgccagggccagggcctgcccctcgtggccttc
cgcttcaagaccgcccaggagggcggcaagcagcgccactacgacgagtttgccctcgcg
caccatctcaggagcaggggctgggttgtccccgcgtataccatggcgccgcatacgaat
gagatgaagatgctcagggtcgtggtcagggaggacttttcaaagagcaggtgtgatttg
ctgattcatgatattaagctgtgcgtcgccatgctggagaatatggatgccgaaacggtg
aggaagcaggaggagtttatcaaggagcatattgcgacccatggcaagacgaagcatcag
cacaggcaccatgcctccaagcactacacgggcgaggaacattcgctgcagggcaagact
ggcaagacgcatgccatttgctaa

DBGET integrated database retrieval system