KEGG   Trichoderma reesei: TRIREDRAFT_123198Help
Entry
TRIREDRAFT_123198 CDS       T02991                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tre  Trichoderma reesei
Pathway
tre00020  Citrate cycle (TCA cycle)
tre00190  Oxidative phosphorylation
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
tre01130  Biosynthesis of antibiotics
tre01200  Carbon metabolism
Module
tre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tre_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRIREDRAFT_123198
  Energy metabolism
   00190 Oxidative phosphorylation
    TRIREDRAFT_123198
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TRIREDRAFT_123198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 18483586
NCBI-ProteinID: XP_006967782
JGI: Trire2_123198
UniProt: G0RRA6
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MAALRSSSRILSSSSRAAFRPSAVFARSMATVSETEQQPRIKSFQIYRWNPDTPTEKPRL
QTYSIDLNKTGPMILDALIKIKNEQDPSLTFRRSCREGICGSCAMNINGQNTLACLCRIP
AESSSDVKIYPLPHTYVVKDLVPDLTHFYKQYKSIEPYLQRDTPAEDGKEYRQSKADRKK
LDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLVDSRDERTAARKSKLENSMS
LYRCHTILNCTRTCPKGLNPGKAIAEIKKQMALGA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctccgctcctcctcacgcatcctcagctcctcgtcgagggctgccttccgc
cccagcgccgtcttcgcgcggtccatggcgacggtcagcgagacggagcagcagcccagg
atcaagtcgttccagatctaccgatggaatcccgacacgccgacggagaagccgcggctg
cagacgtactcgatcgacctcaacaagacgggccccatgatcctcgacgccctcatcaag
atcaagaacgagcaggacccgtcgctgacgttccggaggagctgccgagagggcatctgc
ggcagctgcgccatgaacatcaacggccagaacacgctggcatgcctgtgccgcatcccc
gccgagtcctcgtccgacgtcaagatctacccgctgccgcacacctacgtcgtcaaggac
ctggtgcccgacctgacgcacttttacaagcagtacaagtccattgagccctatctgcag
cgcgacacccctgctgaagatggcaaggagtaccgccagagcaaggcggaccggaagaag
ctggacggcctgtacgagtgcatcctgtgcgcctgctgctcgacgtcgtgcccctcgtac
tggtggaattccgaagagtacctcggccccgccatcctgctgcagtcgtaccggtggctg
gtcgactcccgagacgagcgcacggcggcgcgcaagagcaagctcgagaactccatgagc
ctgtaccgctgccacaccattctcaactgcacgcggacctgccccaagggtctcaacccc
ggcaaggccattgccgagatcaagaagcagatggctcttggcgcatag

DBGET integrated database retrieval system