KEGG   Trichoderma reesei: TRIREDRAFT_1885Help
Entry
TRIREDRAFT_1885   CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tre  Trichoderma reesei
Pathway
tre00500  Starch and sucrose metabolism
tre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRIREDRAFT_1885
Enzymes [BR:tre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TRIREDRAFT_1885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18483895
NCBI-ProteinID: XP_006960925
JGI: Trire2_1885
UniProt: G0R866
LinkDB All DBs
Structure
PDB: 

Position
Unknown
AA seq 632 aa AA seqDB search
MHVLSTAVLLGSVAVQKVLGRPGSSGLSDVTKRSVDDFISTETPIALNNLLCNVGPDGCR
AFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETYDAGLQRRIEQYITAQVT
LQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNY
QSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLG
QSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCD
AGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFA
AAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADG
FLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSAS
TIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVST
QFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQD
GSVTWESDPNHTYTVPAVACVTQVVKEDTWQS
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcctgtcgactgcggtgctgctcggctccgttgccgttcaaaaggtcctggga
agaccaggatcaagcggtctgtccgacgtcaccaagaggtctgttgacgacttcatcagc
accgagacgcctattgcactgaacaatcttctttgcaatgttggtcctgatggatgccgt
gcattcggcacatcagctggtgcggtgattgcatctcccagcacaattgacccggactac
tattacatgtggacgcgagatagcgctcttgtcttcaagaacctcatcgaccgcttcacc
gaaacgtacgatgcgggcctgcagcgccgcatcgagcagtacattactgcccaggtcact
ctccagggcctctctaacccctcgggctccctcgcggacggctctggtctcggcgagccc
aagtttgagttgaccctgaagcctttcaccggcaactggggtcgaccgcagcgggatggc
ccagctctgcgagccattgccttgattggatactcaaagtggctcatcaacaacaactat
cagtcgactgtgtccaacgtcatctggcctattgtgcgcaacgacctcaactatgttgcc
cagtactggaaccaaaccggctttgacctctgggaagaagtcaatgggagctcattcttt
actgttgccaaccagcaccgagcacttgtcgagggcgccactcttgctgccactcttggc
cagtcgggaagcgcttattcatctgttgctccccaggttttgtgctttctccaacgattc
tgggtgtcgtctggtggatacgtcgactccaacatcaacaccaacgagggcaggactggc
aaggatgtcaactccgtcctgacttccatccacaccttcgatcccaaccttggctgtgac
gcaggcaccttccagccatgcagtgacaaagcgctctccaacctcaaggttgttgtcgac
tccttccgctccatctacggcgtgaacaagggcattcctgccggtgctgccgtcgccatt
ggccggtatgcagaggatgtgtactacaacggcaacccttggtatcttgctacatttgct
gctgccgagcagctgtacgatgccatctacgtctggaagaagacgggctccatcacggtg
accgccacctccctggccttcttccaggagcttgttcctggcgtgacggccgggacctac
tccagcagctcttcgacctttaccaacatcatcaacgccgtctcgacatacgccgatggc
ttcctcagcgaggctgccaagtacgtccccgccgacggttcgctggccgagcagtttgac
cgcaacagcggcactccgctgtctgcgcttcacctgacgtggtcgtacgcctcgttcttg
acagccacggcccgtcgggctggcatcgtgcccccctcgtgggccaacagcagcgctagc
acgatcccctcgacgtgctccggcgcgtccgtggtcggatcctactcgcgtcccaccgcc
acgtcattccctccgtcgcagacgcccaagcctggcgtgccttccggtactccctacacg
cccctgccctgcgcgaccccaacctccgtggccgtcaccttccacgagctcgtgtcgaca
cagtttggccagacggtcaaggtggcgggcaacgccgcggccctgggcaactggagcacg
agcgccgccgtggctctggacgccgtcaactatgccgataaccaccccctgtggattggg
acggtcaacctcgaggctggagacgtcgtggagtacaagtacatcaatgtgggccaagat
ggctccgtgacctgggagagtgatcccaaccacacttacacggttcctgcggtggcttgt
gtgacgcaggttgtcaaggaggacacctggcagtcgtaa

DBGET integrated database retrieval system