KEGG   Trichoderma reesei QM6a: TRIREDRAFT_21576Help
Entry
TRIREDRAFT_21576  CDS       T02991                                 

Definition
(RefSeq) glycosyltransferase family 15
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TRIREDRAFT_21576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tre01003]
    TRIREDRAFT_21576
Enzymes [BR:tre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     TRIREDRAFT_21576
Glycosyltransferases [BR:tre01003]
 Glycan extension
  Yeast mannan chain
   TRIREDRAFT_21576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15 PRCH
Motif
Other DBs
NCBI-GeneID: 18484008
NCBI-ProteinID: XP_006962510
JGI: Trire2_21576
UniProt: G0RBI7
LinkDB All DBs
Position
Unknown
AA seq 406 aa AA seqDB search
MASTNARYVRYLLIAFFTILVFYFVSNSKYEGVDLNKGTFTAPDSTKTTPKPPATGDAKD
FPLALTPNDPGFNDLVGIAPGPRMNATFVTLARNSDVWDIARSIRQVEDRFNRRYNYDWV
FLNDKPFDNTFKKVTTSLVSGKTHYGEIAPEHWSFPDWIDQDKAKKVREDMAERKIIYGD
SVSYRHMCRFESGFFFRQPLMMNYEYYWRVEPSIELYCDIHYDPFRLMVEQGKKYSFVIS
LYEYPATIATLWESTKKFMKNHPEHIAPDNSMRFLSDDGGETYNNCHFWSNFEIGSLEWL
RSKQYIDFFESLDKDGGFFYERWGDAPVHSIAAGLMLNRSEIHFFNDIAYWHVPFTHCPT
GEKTRLDLKCHCDPKENFDWKGYSCTSRFFEMNGMDKPEGWENQQD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaacaaatgcgcgctatgtgcgctatctactaatcgccttcttcacaatcctc
gtcttctactttgtctccaattcaaagtatgagggcgtcgatctcaacaagggcaccttc
acagctccggattcgaccaagacgacaccaaagccgccagccactggcgatgccaaagac
tttcctctggccctgacgccgaacgatccaggcttcaacgacctcgtcggcatcgctccc
ggccctcgaatgaacgccacctttgtcaccctcgcccgaaacagcgacgtctgggacatt
gcacgctcgatccgccaggtcgaggatcgcttcaaccgacggtacaactacgactgggtg
ttcctcaacgacaagccgtttgacaacaccttcaagaaggtcacgacgtccctggtgtcg
ggcaagacgcactatggcgagattgcgcccgagcactggtcgttccccgactggatcgac
caggacaaggccaagaaggtgcgcgaggacatggctgagcgcaaaatcatctacggcgac
tcggtcagctaccgccacatgtgccgcttcgagtcgggcttcttcttccgccagccgctg
atgatgaactacgaatactactggcgcgtggagccctccatcgagctctactgcgacatc
cactacgaccccttccgcctgatggttgagcagggcaaaaagtacagcttcgtcatcagc
ctgtacgagtacccggccacgattgccacgctgtgggagagcaccaagaagtttatgaag
aaccatccggagcacattgcccccgacaactcgatgcgcttcctgagcgatgacggcggc
gagacgtacaacaactgccacttctggtccaactttgagattggcagcctggagtggctg
cgcagcaagcagtacattgactttttcgagtccctggacaaggacggcggcttcttctac
gagcgatggggcgacgctcccgtccactccattgccgccggcctgatgctcaacaggagc
gagattcacttcttcaacgacattgcctactggcatgtgccctttacccactgccccacg
ggcgagaagacgagactggatctgaaatgccactgcgaccccaaggagaactttgattgg
aagggctactcttgcacatcccgattctttgagatgaacggcatggacaagcccgaaggc
tgggagaaccagcaagactaa

DBGET integrated database retrieval system