KEGG   Trichoderma reesei: TRIREDRAFT_50531Help
Entry
TRIREDRAFT_50531  CDS       T02991                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tre  Trichoderma reesei
Pathway
tre00020  Citrate cycle (TCA cycle)
tre00310  Lysine degradation
tre00380  Tryptophan metabolism
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
tre01130  Biosynthesis of antibiotics
tre01200  Carbon metabolism
Module
tre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRIREDRAFT_50531
  09105 Amino acid metabolism
   00310 Lysine degradation
    TRIREDRAFT_50531
   00380 Tryptophan metabolism
    TRIREDRAFT_50531
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     TRIREDRAFT_50531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N baeRF_family12
Motif
Other DBs
NCBI-GeneID: 18485327
NCBI-ProteinID: XP_006967477
JGI: Trire2_50531
UniProt: G0RQ88
LinkDB All DBs
Position
Unknown
AA seq 1036 aa AA seqDB search
MWRNSLLRGVQAARLATRPTRLAALPRPLTLTTRRLYAATTTTSNATASAPDPSDNFLSG
STANYIDEMYMQWKQDPKSVHVSWQVYFKNIESGDMPISQAFQPPPNLVPGMTGGVPRLA
GGLTLDDGSDVTNHLKVQLLVRAYQARGHHKADIDPLGIRNTSAGFGNIKPKELSLEHYG
FTEKDLDTQYTLGPGILPRFKREGRDKMTLREIIAACEKIYSGSYGVEFIHIPDREKCDW
LRERLEVPQPFKYSIDEKRRVLDRLIWSSSFESFLATKYPNDKRFGLEGCETLVPGMKAL
IDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGSLNAGDEGSGDVKYHLGM
NFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKDHKTAMSVLLHGDAA
FAAQGVVYECLGFHSLPAFSTGGTVHLVVNNQIGFTTDPRFARSTAYCTDIAKAIDAPVF
HVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQPSFTQPLMYKRIQEK
VPQIDIYVDKLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPTSKEWTTSAWNGFKS
PKELATEVLPHNDTSVDRASLNHIGEVIGSAPEGFHIHRNLKRILNNRTKSVTEGKNIDF
PTAEALAFGSLATEGYHVRVSGQDVERGTFSQRHAVFHDQETEETYTPLQHVSKDQGKFV
ISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQFIASGEAKWMQRTG
LVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPPEDKLPRQHQDCNMQIVYMTTPAN
LFHVLRRQMHRQFRKPLVIFFSKSLLRHPLARSNIEEFTGPDAGFKWIIPDPEHQTGNIK
SPEEIDRVILCTGQVWASLHKYRADNKIDNVAFTRIEQLNPFPWQQLKENLDMYPNAKTI
VWAQEEPLNAGAWSFTQPRIETLLNQTQYHDRKHVMYAGRNPSASVATGLKTMHMKEEQE
LLEMAFTVTQDKLKGE
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggaactctctgctgaggggcgtccaggccgcccgcctcgccacgaggccgacg
aggcttgccgccctccccaggcccttgaccctgaccacgaggcgcctctacgccgccacg
acgacgacgtccaatgctacggcctcggcccccgaccccagtgacaacttcctgtccgga
agcactgccaactacatcgatgagatgtacatgcagtggaagcaggatcccaagagcgtc
cacgtatcatggcaggtctacttcaagaacatcgagagcggcgacatgcccatctcccag
gccttccagccgcccccgaacctggtccccggcatgacagggggcgtccctcgtctcgcc
ggcggcctgacccttgacgacggctccgacgtcaccaaccacctcaaggtccagctgctg
gtgcgcgcatatcaagcccgtggacatcacaaggctgacatcgaccctctcggcatccgc
aacacctctgccggctttggtaacatcaagcccaaggagctgtctctcgagcactatggc
ttcaccgaaaaggacctcgacacccagtacacccttggacccggcatcctgcccaggttc
aagcgggagggccgtgacaagatgaccctgcgagagatcattgccgcgtgcgaaaagatc
tactctggctcatatggcgttgagttcatccacatccccgaccgcgagaagtgcgactgg
ctgcgcgagcgcctcgaggtgccccagcccttcaagtactccatcgatgagaagcgccgc
gtcctcgaccggttgatctggagctccagcttcgagtcgttcctcgccaccaagtatccc
aacgacaagcgattcggtcttgagggttgcgagaccctggttcccggcatgaaggctctg
attgaccgcagcgtcgactacggtgtcaaggacattgtgatcggcatgcctcaccgaggc
aggttgaacgtgctgagcaacgtcgtccgaaagccaaacgagtccatcttcagcgagttc
gcaggctccctcaacgctggagatgagggctccggcgacgtcaagtaccacttgggcatg
aacttcgagcgccccacgccttctggcaagcgcgtgcagctctcgctcgtcgccaacccc
tcccatttggaagccgaggaccctgttgtgcttggcaagacccgcgccatccagcactac
aacaacgacgagaaggaccacaagaccgccatgagcgtcctgttgcacggagatgccgcg
ttcgcagcccagggcgtcgtctacgaatgtcttggattccactccctgccggccttttct
accggcggtaccgtccacctcgtcgtcaacaaccagattggtttcaccactgaccctcga
ttcgcgcgatccacggcctactgcacggatatcgccaaggccatcgatgccccggtgttc
cacgtcaacgccgacgacgtcgaggccgtcaactttgtctgccaattggccgctgactgg
cgagccgagttccagcacgacgttgttattgacttgatctgctaccgcaagcatggccac
aacgagactgaccagccctcgttcacccagcctctcatgtacaagcgcatccaggagaag
gtgccccagattgacatttacgtcgacaagttgttgaaggaaggcacttttaccaaggaa
gacattgaggagcacaagcagtgggtatggggcatgcttgaggagagtttctcaaaatcc
aaggactaccaacccacgtccaaggagtggacgacgtcggcctggaatggcttcaagtcg
cccaaggagctcgccaccgaggtccttccccacaacgacaccagcgtcgaccgagcttcg
ctgaaccacattggcgaagtcattggatcggcccctgaaggcttccacattcaccgaaac
ctcaagcgaatcctcaacaaccgcacgaaatctgtcactgagggcaagaacattgacttc
cctaccgccgaggccctggcctttggctccctcgccaccgagggctaccatgtgagagtc
tccggacaggatgtcgagcgtggcaccttctcgcagcgccatgctgtcttccatgaccag
gaaaccgaggagacatatacccccctgcagcatgtcagcaaggaccaagggaagttcgtc
atttccaactcgtccttgagcgagtttggtgccctcggcttcgagtacggctactccctg
tcgtcgcccaatgcgctggtcatgtgggaggcgcagtttggtgacttcgccaacaacgcc
cagtgcatcatcgaccagttcattgcctctggcgaggccaagtggatgcagagaaccggt
ctggtcatgtccctgccccacggctacgacggccagggtcccgagcactcctccggccgc
ttggagcggtacttgcagctttgcaacgaggaccctcgcgtgttcccgcccgaagacaag
cttccgcgccagcaccaagactgcaacatgcagattgtttacatgaccactcccgccaac
ttgttccacgtcctccgtcgacagatgcaccgacagttccgaaagccccttgtcatcttc
ttctccaagtccctgctccgtcacccgttggcacgatccaacattgaggagttcaccggt
cccgatgcgggattcaagtggatcatccccgatcccgagcaccagactggcaacatcaag
tctcctgaagagattgaccgagtcatcctctgcactggtcaggtctgggccagcctgcac
aagtaccgtgccgacaacaagatcgacaatgtggcctttacccgtatcgagcagctgaac
cccttcccctggcagcagctgaaggagaacctggacatgtaccccaacgcgaagaccatc
gtctgggcacaggaggagcccctcaacgcgggagcctggagcttcacgcagccgcgtatc
gagacgctgctcaaccagacccagtaccacgatcgcaagcacgtcatgtatgccggtcgc
aaccccagcgcctccgtggcaaccggcttgaagactatgcacatgaaggaggaacaggag
ctgttggagatggcttttactgttacgcaggacaagctgaagggcgagtag

DBGET integrated database retrieval system