KEGG   Trichoderma reesei QM6a: TRIREDRAFT_56376Help
Entry
TRIREDRAFT_56376  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
Organism
tre  Trichoderma reesei QM6a
SSDB OrthologParalogGFIT
Motif
Pfam: Filament GIT_CC
Motif
Other DBs
NCBI-GeneID: 18485989
NCBI-ProteinID: XP_006962741
JGI: Trire2_56376
UniProt: G0RCE2
LinkDB All DBs
Position
Unknown
AA seq 1035 aa AA seqDB search
ATHSRSQTLDYVDPSAATLISPVAASSLPFRFSGPIKRKPVSSTAASSSLVSQYLQGSPL
LHTTTIDLPKPDHRFARPPSVDSPTFYEYPASVRASTAAELAPSDDETAAASGNISTRSG
PPAETADTESSAGLSVYDDLLPDLTPDGTPDAASVNERDQATDSASDIESNYDDGSNPPP
SPPMLAPTKHAPPHLRLEKVDPSVHIGDGPQTYIDDSPQSAAIDGSPKLNKPLPRSPGAT
SPLASIFGWGNSSSTELSSSPLSPNAKGSANDNRRSTNSLSSRYTKPNATTTLAQQRESF
FSTHSPHLSQNTALIEEMEDELKAISSELAASIRREIDLEDLADRLQEQLSSNPQTLASK
RTSDYFSDSGHSTAKLGEFDHTRDEIEKVQRRSEQERASLRLELTSKLQEEREKRKDLDQ
KIRQLQERASEVDVVEINNMDATERIKELESTCEDLRRKLSEERQSKANFEDILAALKSQ
LQEASDERDNLRDEVVPELKARVEGLESEAAEYANLTYESSRMQQELHTLKRENSSLRNS
MAGGIDELPTKRMSVIGLSGLSGLSSLSRSNSSGLSRSNSVATGSRNRVPPGLGGLKRSD
SFKTAAQTDSRETLLERLKDVEEQRDALHGALKSLLERHEFQNREYQKKIRMLEKERQRL
TTVTPRKAGFEKDMSKLRTEINLLRRRAEDALEQKWQVEKGLGGLKIDLDRAEEEIQSLR
GLLKENDILIPPSIARLSSSSDTGREPVTSESLRTAYAELQAAYTESLARIRELEDSASD
DETKEAMDRLERSLSAAVLERDAARREVDQQKAQISMLAADEAQSAAADGTLAEQLKESA
DLIEQLTTQVRQQLDTNTELRTRLEAAVARGEADRKTNSQRISELQERLRVLEDQVVAAQ
TASEDRVVRHEEEITRLREAHNEQLRRLQADPADGSSHKSGSKPLLSTRSIASKSLEEEA
DMKTLRARVLELEKALGEAEDEMQEVVARMNMAQVEVLNLQEDREAAVRETRRLEELLKK
EQSKAGFGGFFASRS
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
gccactcacagccgttcccagacgctcgactacgtagatccctctgctgccaccctcatc
tcgccggtagctgcctcctctcttccctttcgcttctccggtcccatcaagcgcaagccc
gtgtccagcaccgcggcctcttcctcgcttgtctcgcagtacctccagggctctcctctg
cttcacaccaccaccatcgacctgcccaagcccgatcaccgattcgcgcggccgccatcc
gtcgacagtcccaccttctacgagtaccctgcctctgtgcgagcttctactgccgcagag
ctggcgccaagcgacgacgaaacagctgctgcttcgggaaacatatccacccgcagcggg
cctcccgctgaaaccgctgacacggaatcctctgctggactgtcagtgtacgacgacttg
ctgccggatctgacacccgacggcacgcctgacgctgcgtctgtcaacgagcgcgaccaa
gccacggacagcgcctccgacatcgagtccaactacgacgacggctcgaatccccctccc
tctccgcccatgttggccccgaccaagcacgcacctccgcatctacggctcgaaaaggtc
gatccctctgttcatataggcgacgggccgcagacgtacattgacgactcgccccagtcc
gccgccatagacgggtcgccgaagctcaacaaaccgctgcccaggtcaccaggcgcaacc
tctccactggcttccatcttcggctgggggaactcgtcctccacggagctgtcatcgtcg
cctttgtcgccgaacgctaagggctcggccaatgacaatcgacggtcaacgaacagcctc
tcgtcaaggtatacaaagcccaatgcaaccacgactctcgcccaacagcgcgaatccttc
ttctcgacgcactcaccccacctctcccaaaacacagccctgatcgaagagatggaagac
gagctgaaggccatcagctcggagctggctgcatcgatccgccgcgagattgacctggaa
gacctggccgataggctccaggagcagctctccagcaacccccagacgctcgccagcaag
cgaacaagcgactacttctccgactctggccacagcacagccaagctcggcgagtttgac
cacacccgggatgagattgaaaaggtgcagaggaggtcggagcaggagagagcttccctc
cgcctcgagctgacatcgaagctgcaagaagagagggaaaagaggaaggatctcgaccag
aagattaggcagcttcaggagcgagcttccgaagtagacgttgtcgagatcaacaacatg
gatgctaccgagcgcatcaaggaactggaaagcacttgcgaggatctgcgccggaagctg
tcagaggagcgtcagtccaaggccaactttgaagacatcctggccgccctcaagtctcag
ctacaggaagcctctgatgagcgagataatctccgcgacgaggtcgttccggagctcaag
gcgcgagtcgaaggcttggagtctgaggcagccgagtatgccaacctgacgtacgaatcc
tccaggatgcagcaggagctgcacaccctgaagcgagagaacagctcactgcgcaactcc
atggccggcggcatcgacgaattgcctactaagcgaatgtcagtcatcggactgtctggc
ctctctggactctccagtctgtcccggtccaattcgagtggcctctcgcgctccaactct
gtggctaccggatcgcgcaaccgcgtccctcccggcctcggcggactcaagagatctgac
agctttaagacggctgcgcagactgactctcgcgagaccttgctcgagcgactgaaggac
gtggaagagcagcgcgacgccctccacggcgccctcaagagtctgttggagcgacacgag
ttccagaaccgcgagtaccagaagaagattcgcatgctggagaaggagcgccagcggctc
acgacggtgacgccccgcaaggccgggttcgagaaggacatgagcaagctgcgcaccgag
atcaacctcctgcgacgacgcgccgaggatgctctcgagcagaagtggcaggttgaaaag
ggcctcggcggcctcaagattgatctggaccgagcggaagaggagattcagtctctgcgt
ggtcttctcaaggagaacgacattctgatccccccttccattgctcgcctgagcagctct
agcgacactggccgagagcccgtcacgtccgagtcgctccggacggcgtacgcggagctg
caggccgcatacaccgaatctctggcgcgcatccgcgagctcgaagactctgcctctgac
gatgagaccaaagaggccatggatcgcctagagcgctcgctctccgccgcagtgcttgag
cgtgacgcagccagaagggaggttgaccagcagaaggctcagatcagcatgctggcggct
gacgaggcccagtcggctgcggccgacggcactctggccgagcagctcaaggagtctgcc
gatctcattgagcagctcacgacccaggttcgtcaacagctggacaccaacaccgagctg
cgaacacgtctggaagctgccgtcgctaggggagaagcggatcgcaagaccaactcacag
cgcatctcggagctccaggagcgtcttcgtgtcctggaggaccaggtcgtcgccgcccag
accgcgtcggaggaccgcgtcgtccgtcatgaagaggagattacccggctgcgcgaagcg
cataacgagcagcttcgtcgccttcaggctgatcccgccgatggctcgtcgcacaagtcg
ggctcgaagccgctgctcagcacgcggtccattgcttccaagagcctcgaagaagaggct
gatatgaagacactccgggcgcgcgtccttgagctcgaaaaggcccttggcgaggccgag
gacgaaatgcaagaggtcgtggctaggatgaacatggcccaggttgaggtcctcaacctc
caggaggaccgtgaggcagccgtccgagagactaggcgactcgaggagctgctgaagaag
gagcagtccaaggccggctttggcgggttctttgcctctcggagctga

DBGET integrated database retrieval system