KEGG   Trichoderma reesei QM6a: TRIREDRAFT_67467Help
Entry
TRIREDRAFT_67467  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K11274  chromosome transmission fidelity protein 4
Organism
tre  Trichoderma reesei QM6a
Brite
KEGG Orthology (KO) [BR:tre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tre03036]
    TRIREDRAFT_67467
Chromosome and associated proteins [BR:tre03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    TRIREDRAFT_67467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid ANAPC4_WD40 WD40 Coatomer_WDAD eIF2A
Motif
Other DBs
NCBI-GeneID: 18487585
NCBI-ProteinID: XP_006968154
JGI: Trire2_67467
UniProt: G0RSF1
LinkDB All DBs
Position
Unknown
AA seq 854 aa AA seqDB search
MDSTGAPRPRPRPAHTQGTTRCAYTKDGSRLVTVGSNNTIRLYKTGSDGEPTNIDDCQEQ
NVAVAAAQDFFVVGSEDGTVSLYSLATANFDRFLVRTSLPVRDVALSGDAQWCAVASDEL
TVKVVNTQDIKQLRHLNEHGRAARSVSLDPNGRIAALSCVDGIIYIYSLTADQPELIHKV
DGVIGAGEADSEASVKAVWHPDGRAFAVATPTRDIQVISKNDWERQRAFTDGHSADITAL
AWSPNGVMLASACKGGKVLVWETSTQNVIQRYDYSNVIDLAWHPSKNILSFTTTEGEVYI
YPDFLSDQFSPMLKLPVQPAPFIHDPLLEISANRRAAVANGAKRDIPTRPRRDSLGSLDS
YLQDENYADGDDDGFVVDDDGAGYTVGQKRGYVGDDVLGGAEYSNKRRHLMEPQYHEAFQ
PGSTPWRGNRKYLCLNLVGFVWTVDQDGHHTVTVEFYDHEFQRDFHFTDTFLYDKACLNE
RGTLFSCPPRDDQPATIFYRPHETWTQRTDWRTQLPKGEAVTAMSLSESFVTVVTSANYV
RIFTLFGIPYRVYRPKSAPMVTCASWRDYVLTIGNGPVTADGNTRLLYTIENVKRDEICQ
NEDTVALPEGATLKSAFFSDNGDPCIYDSTGTLLTLLHWRQPSRASWVPLLDTKLLPRLA
SGRKSETYFPIAVAENKFHCIILKGGDQYPYFPRPLLSEFDFSIPLHSLPEPKTKKNRVD
GEDAVMDDDDDGDDDEEEEGAETRKLEQQFLLKGVQAAQLRDLVDATSGSHAQRSLLSRI
ELEIDKTLLQLLAVECREGEERGMRALEMVELMRDRTGRMMEAAYKVAERYGRTILGEKI
REVGESRVSGEDDF
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggactcgaccggcgcgcctcgtcctcgcccacggcctgcgcacacccagggcacgact
cgatgcgcctacaccaaggacggcagccggctggtgacggtgggctccaacaacacgatc
cggctctacaagacgggctccgacggcgagccgacaaacattgacgactgccaggagcaa
aacgtcgccgtggccgcggcccaggacttcttcgtcgtcggctccgaggacggcaccgtc
agcctctactcgctggccacggccaacttcgaccgcttcctcgtgcggacgtcgctgccc
gtgcgggacgtggcgctctcgggagacgcgcagtggtgcgccgtggccagcgacgagctg
accgtcaaggtcgtgaacacgcaggatatcaagcagctgcggcacctcaacgagcacggg
cgggcggctcgatccgtcagcctggatcccaacggccggatcgccgccttgtcgtgcgtc
gacggcatcatatacatctattcgctgacggcggaccagcccgagctgatacacaaggtg
gacggcgtgattggcgcgggggaggcagactcagaggcctcggtcaaggccgtttggcat
ccggacggcagggcgtttgcggttgcgacgccgacgcgggacatccaggtcatctccaag
aacgactgggagaggcagcgcgcctttaccgacggacactcggccgacatcaccgctctc
gcctggtcgcccaacggagtcatgctggcgtcggcctgcaagggcggcaaggtgctggtc
tgggaaaccagcacgcagaacgtcatccagcgctacgactattccaacgtcatcgacctg
gcgtggcacccgtccaagaacattctctccttcaccacgacggagggagaggtctacatc
taccccgactttctctccgaccagttctcgccgatgctgaagctgccggtacagccagcc
cctttcattcacgaccccctcttggagatttcggccaacagaagagctgctgtggccaac
ggcgcgaaacgtgatattcctacacgccctcgccgggactctctgggcagccttgactcc
tacctgcaggacgagaactatgcagatggtgatgacgatggcttcgtcgtggacgacgac
ggcgctgggtataccgttggccagaagcggggctatgtaggcgatgatgttcttggcggt
gctgaatactccaacaagcggaggcatctcatggaaccgcagtatcacgaagcctttcag
cctggatcgacgccgtggagagggaaccgcaagtatctctgcctgaacctcgtcggtttc
gtctggacggtggatcaagacgggcaccataccgtcacggttgagttttacgaccacgag
ttccagcgggactttcactttacggatacctttctgtacgacaaggcatgtctcaatgag
cgcggcaccctgttttcgtgtcccccaagggatgaccagccggcaaccatcttctaccgc
cctcacgagacctggacgcagcggaccgactggcgaacacagctccccaagggggaggcc
gtcaccgccatgtcactcagcgaatcctttgtgacggtcgtcacgagtgccaactacgtg
cgcatctttacgctgtttgggatcccataccgcgtctatcgccccaagagcgcgcccatg
gttacgtgtgcgagctggagagactatgttctcaccatcggcaacggccctgtcaccgct
gacggcaacacacgacttttatacacgattgagaatgtcaagagagacgagatttgccag
aatgaggatacggtggcgcttcctgaaggcgcgacattaaagagtgccttcttttctgac
aatggggatccttgcatctatgattcaacaggcacattgctcacactgctgcactggcgt
cagccatcgcgggcgtcgtgggttcccctattagacaccaagcttcttccccgtctcgct
tctggacgcaagagcgagacgtatttccccattgccgtagcagagaacaagtttcactgc
atcatcctcaagggtggcgaccaatatccatactttccccggcccctgctctccgagttt
gacttttctattccgctacactcattaccggaaccaaagacgaagaagaacagggtcgat
ggagaggatgcggtaatggacgacgacgacgacggtgatgatgacgaggaagaggagggc
gccgagacgaggaagctggagcaacagtttttgctcaagggcgtgcaggcggctcagctc
cgtgacctggtcgacgccacttccggaagccatgctcagcggtcactgctgtcgcggatc
gagctggagattgacaagacgctcctgcagctcctggcggtagagtgccgcgagggcgag
gagaggggcatgcgcgcgctggagatggtggagctgatgcgtgaccgcaccggccggatg
atggaggcggcgtacaaggttgcggagcggtacgggcggacgattctgggggagaagatt
cgggaggttggggagagtagggtcagtggggaggatgatttctga

DBGET integrated database retrieval system