KEGG   Trichoderma reesei: TRIREDRAFT_73665Help
Entry
TRIREDRAFT_73665  CDS       T02991                                 

Gene name
hxk1
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tre  Trichoderma reesei
Pathway
tre00010  Glycolysis / Gluconeogenesis
tre00051  Fructose and mannose metabolism
tre00052  Galactose metabolism
tre00500  Starch and sucrose metabolism
tre00520  Amino sugar and nucleotide sugar metabolism
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
tre01130  Biosynthesis of antibiotics
tre01200  Carbon metabolism
Module
tre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIREDRAFT_73665 (hxk1)
   00051 Fructose and mannose metabolism
    TRIREDRAFT_73665 (hxk1)
   00052 Galactose metabolism
    TRIREDRAFT_73665 (hxk1)
   00500 Starch and sucrose metabolism
    TRIREDRAFT_73665 (hxk1)
   00520 Amino sugar and nucleotide sugar metabolism
    TRIREDRAFT_73665 (hxk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TRIREDRAFT_73665 (hxk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tre04131]
    TRIREDRAFT_73665 (hxk1)
Enzymes [BR:tre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TRIREDRAFT_73665 (hxk1)
Membrane trafficking [BR:tre04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    TRIREDRAFT_73665 (hxk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18488229
NCBI-ProteinID: XP_006961576
JGI: Trire2_73665
UniProt: G0R712
LinkDB All DBs
Position
Unknown
AA seq 492 aa AA seqDB search
MVGLGPRPPPSRKGSAADLPKDLLNEVRKLEEIFTVDTAKLKEITDHFVNELAKGLSVEG
GSIPMNPTWVMSYPDGHETGSFLALDMGGTNLRVCEITLTDRKSEFDIIQSKYRMPEELK
TGSSEELWEYIADCLHQFIETHHGDCSKLEALPLGFTFSYPATQHYIDEGILQRWTKGFD
IAGVEGKNVVPMFEAAIAKRGVPIKLSALINDTTGTLIASAYTDPKVKIGCIFGTGCNAA
YMEDCGSIPKLAHMNLPPDCPMAINCEWGAFDNEHKVLPRTKYDIAIDEDSPRPGQQAFE
KMIAGLYLGEIFRLVLVDLHDNKDIHIFENQDISLLRRPYTLDSSFLSGIEEDPFENLQE
TFDTFQSKLNITPTGPELELVRRLSELIGTRAARLSACGVAAICKKKSFESCHVGADGSV
FNKYPHFKARGAKALREILDWPAKSNPKEEDPVEILAAEDGSGVGAALIAALTLKRAKAG
NLAGILHPENFV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggttggactcggccctcgcccgcctccctctagaaagggctcagctgcggatttgccc
aaggatctcctcaacgaggtgaggaagctggaggagatcttcactgtcgacaccgccaag
ctcaaggagattacggaccactttgtcaatgagctcgccaaaggtctcagtgtggagggt
ggcagcatcccaatgaaccctacctgggtcatgtcttaccctgatggccacgagactggt
tctttcctggctctggacatgggtggcaccaacctgcgggtgtgcgaaatcaccttgacg
gaccgcaagtcggagttcgacatcatccagtccaagtaccgcatgccggaagagctcaag
accggctccagcgaggagctgtgggagtacatcgccgactgcctgcaccagttcatcgag
actcaccacggcgactgcagcaagctggaggccttgcctcttggcttcaccttctcctac
ccggccactcagcactacatcgacgagggcatcctccagcgctggaccaagggcttcgat
attgccggtgttgagggaaagaatgtcgtgcccatgttcgaggctgcgattgctaagcgt
ggtgtgcccatcaaactgtcggctttgatcaacgacacgacaggcacattgattgcttcc
gcctacacagaccccaaggtgaagattggctgcatcttcggaacgggatgtaatgccgcc
tacatggaggattgcggctccatccccaagctggcgcacatgaacctcccccctgactgc
cccatggccatcaactgcgagtggggtgcctttgacaacgagcacaaggtcctgccccgc
accaagtacgacatcgccatcgatgaagactctcctcgccctggccagcaggcgtttgag
aagatgattgccggtctctacctgggcgagatcttccgactggtcctggtggacctgcat
gacaacaaggacattcacatctttgagaaccaggacatctctttgctccgcaggccctac
acattggattcatccttcctctctggcatcgaagaggaccccttcgagaacctccaagag
acctttgataccttccagtcgaagctcaacatcacacccacgggacccgagcttgagctg
gtccggaggctgtcagagctcatcggaacacgagctgcccgactgtccgcctgcggtgtc
gcggccatctgcaagaagaagagctttgaaagctgccacgtcggtgccgacggatccgtc
ttcaacaagtaccctcacttcaaggcccgcggcgccaaggccctgcgagagatcctcgac
tggcccgcgaagagcaaccccaaggaggaggacccggtggagattctggcagccgaggat
ggcagcggtgttggcgctgccctgattgcggccctgacgctcaagcgggccaaggctggc
aacttggccggcattttgcatcctgagaattttgtctag

DBGET integrated database retrieval system