KEGG   Trichoderma reesei: TRIREDRAFT_74103Help
Entry
TRIREDRAFT_74103  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tre  Trichoderma reesei
Pathway
tre00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TRIREDRAFT_74103
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tre02000]
    TRIREDRAFT_74103
Enzymes [BR:tre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TRIREDRAFT_74103
Transporters [BR:tre02000]
 Other Transporters
  Pores ion channels [TC:1]
   TRIREDRAFT_74103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 18488294
NCBI-ProteinID: XP_006961733
JGI: Trire2_74103
UniProt: G0R8K5
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MGSVDTSIHSAASGAAAQLVARHADEQPLKLYAGWFCPFVQRAWMTLEEKKIPYQYIEIN
PYKKEPDFLKLNPRGLVPTLGVPVDAAGTQQKPLFESSIIMEYLDEAYADEAQHGPRLLP
GDPYQRARARLWIDHVNSRIIPAFYKFLQHTPEKDYSIDEAREELHKHIKTLVAEMDPEG
PWFLGRDISLVDISLAPWAKRLFLINHYKPGGLQIPGEGGEGNVWTRWSSWMKAIEDRPS
VKNTWSEEDKYIEVYKRYAEDTTNSQVGQATRKGTKLP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgtcgacacttcgattcactcagcagccagcggcgctgccgctcaactggta
gctcgccacgcagacgaacagccactcaagctctacgcaggctggttctgcccctttgtc
caacgagcctggatgacgctcgaggagaagaagatcccgtaccagtacatcgagatcaac
ccctacaaaaaggagccagacttcctcaagctgaacccgcgcggcctcgtgcccacgctg
ggcgtgcccgtcgacgccgcggggacgcagcagaagccgctctttgaaagctccatcatc
atggagtacctcgacgaggcgtacgcagacgaggcccagcacggccctcgcctgctgccg
ggggatccgtatcagagggccagggcgaggctgtggatcgatcacgtcaattcgaggatc
attccggcgttttacaagttcctgcagcacacgcctgagaaggactattctatcgacgag
gcacgcgaagagcttcacaagcacatcaagactctggtggcggagatggatcctgagggc
ccgtggttcctggggagggacataagcttggtggacataagcttggcgccttgggcgaag
aggctgtttttgatcaatcactacaagcctggcgggcttcagatcccaggggagggtggt
gaggggaatgtgtggacgagatggagctcgtggatgaaggcgattgaggatcggccaagc
gtcaagaatacatggagcgaggaggacaagtatatcgaggtgtacaagagatatgcagag
gacacgacgaattcgcaggtgggacaggcgacacgtaagggaaccaagcttccatag

DBGET integrated database retrieval system