KEGG   Trichoderma reesei: TRIREDRAFT_74346Help
Entry
TRIREDRAFT_74346  CDS       T02991                                 

Definition
(RefSeq) translation elongation factor precursor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
tre  Trichoderma reesei
Brite
KEGG Orthology (KO) [BR:tre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tre03012]
    TRIREDRAFT_74346
   03029 Mitochondrial biogenesis [BR:tre03029]
    TRIREDRAFT_74346
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tre04147]
    TRIREDRAFT_74346
Translation factors [BR:tre03012]
 Eukaryotic Type
  Elongation factors
   TRIREDRAFT_74346
 Prokaryotic Type
   TRIREDRAFT_74346
Mitochondrial biogenesis [BR:tre03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TRIREDRAFT_74346
Exosome [BR:tre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRIREDRAFT_74346
  Exosomal proteins of breast cancer cells
   TRIREDRAFT_74346
  Exosomal proteins of colorectal cancer cells
   TRIREDRAFT_74346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 18488324
NCBI-ProteinID: XP_006961877
JGI: Trire2_74346
UniProt: G0R758
LinkDB All DBs
Position
Unknown
AA seq 446 aa AA seqDB search
MSTAFRSIAPFLRTARHGLKGGSINPLQAALKNNRGAAGALNIARTYAVFERTKPHVNIG
TIGHVDHGKTTLSAAITKRQAEKGLANFLEYGAIDKAPEERKRGITISTAHIEYSTDNRH
YSHVDCPGHADYIKNMITGAANMDGAIIVVAASDGQMPQTREHLLLARQVGVQKIVVFVN
KVDAIDDPEMLELVEMEMRELLNTYGFEGDETPVIMGSALMALQNQKPEIGEQKIDELLK
AVDEWIPTPERDLDKPFLMSVEDVFSISGRGTVVSGRVERGVLKRDEEVELVGKGVEPIK
TKVTDIETFKKSCEQSQAGDNSGLLIRGIRREDVRRGMVVCKPGTVKSHKQFLASLYVLT
KEEGGRHTGFHEHYRPQLYLRTSDESVDLTFPEGTPDASGKMVMPGDNVEMVVTLTNPNA
IEVGQRFNIREGGRTVATGLVTRIMQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggcattcagatcaattgctccgttcctgcggacggcccggcatggcctcaag
ggcggcagcatcaacccgctgcaggctgccctcaagaacaaccgaggcgctgcgggtgct
ctcaacatcgctcgcacatacgccgttttcgagcgaaccaagccgcacgtgaacattggt
accattggccacgtcgatcacggaaagaccactctctccgctgccatcaccaagcgacag
gccgaaaagggcctggccaacttcctcgagtatggcgccatcgacaaggcccccgaggag
cgaaagcgaggcatcaccatctctaccgcccacattgagtactccacggacaaccgccac
tactcccacgtcgactgccctggccacgccgattacatcaagaacatgattactggtgct
gccaacatggacggtgccatcatcgtcgtcgccgcctccgatggtcagatgccccagacc
cgtgagcacttgctgcttgcccgtcaggtcggtgtccagaagattgttgtcttcgtcaac
aaggtcgacgccatcgacgaccccgaaatgcttgagctcgtcgagatggagatgcgcgag
ctgctcaacacctacggcttcgagggtgacgagacccctgtcatcatgggttccgccctg
atggctctccagaaccagaagcccgagattggtgagcagaagattgacgagctcctcaag
gccgtcgacgagtggatccccacccccgagcgtgacctcgacaagcccttcctcatgtct
gtcgaggacgtcttctccatctctggccgtggtaccgttgtttccggacgtgtcgagcgc
ggtgtcctcaagcgtgatgaggaagtcgagctcgtcggcaagggtgttgagcccatcaag
accaaggtcaccgacatcgagaccttcaagaagtcctgcgagcagtcccaggccggtgac
aactctggtctcctgatccgcggtatccgccgtgaggatgttcgccgtggtatggtcgtc
tgcaagcccggtaccgtcaagtcgcacaagcagttcctcgcctctctctacgtcctcacc
aaggaggaaggtggtcgccacactggcttccacgagcactaccgacctcagctctacctg
cgaacctccgacgagtccgtcgacctgaccttccccgagggcactcccgatgcctctggc
aagatggtcatgcccggtgacaacgtcgagatggttgtcaccctgaccaaccccaacgcc
attgaggttggccagcgattcaacatccgtgagggcggcaggaccgtggccactggtctg
gtcacccgcatcatgcagtaa

DBGET integrated database retrieval system