KEGG   Trichoderma reesei QM6a: TRIREDRAFT_81271Help
Entry
TRIREDRAFT_81271  CDS       T02991                                 

Gene name
xdh1
Definition
(RefSeq) xylitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00040  Pentose and glucuronate interconversions
tre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TRIREDRAFT_81271 (xdh1)
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     TRIREDRAFT_81271 (xdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C HI0933_like AdoHcyase_NAD UDPG_MGDP_dh_N FAD_binding_3 Pyr_redox Prot_ATP_ID_OB
Motif
Other DBs
NCBI-GeneID: 18489305
NCBI-ProteinID: XP_006968491
JGI: Trire2_81271
UniProt: G0RTG1
LinkDB All DBs
Position
Unknown
AA seq 363 aa AA seqDB search
MATQTINKDAISNLSFVLNKPGDVTFEERPKPTITDPNDVLVAVNYTGICGSDVHYWVHG
AIGHFVVKDPMVLGHESAGTVVEVGPAVKSLKPGDRVALEPGYPCRRCSFCRAGKYNLCP
DMVFAATPPYHGTLTGLWAAPADFCYKLPDGVSLQEGALIEPLAVAVHIVKQARVQPGQS
VVVMGAGPVGLLCAAVAKAYGASTIVSVDIVQSKLDFARGFCSTHTYVSQRISAEDNAKA
IKELAGLPGGADVVIDASGAEPSIQTSIHVVRMGGTYVQGGMGKSDITFPIMAMCLKEVT
VRGSFRYGAGDYELAVELVRTGRVDVKKLITGTVSFKQAEEAFQKVKSGEAIKILIAGPN
EKV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcaaacgatcaacaaggatgcgatcagcaacctctccttcgtcctcaacaag
cccggcgacgtgacctttgaggagcggccgaagccgaccatcacggaccccaacgacgtc
ctcgtcgccgtcaactacacgggcatctgcggctccgacgtgcactactgggtgcacggc
gccatcgggcacttcgtcgtcaaggacccgatggtgctgggccacgagtcggccggcacc
gtcgtcgaggtcggcccggccgtcaagagcctcaagcccggcgaccgcgtcgccctcgag
cccggctacccgtgccggcggtgctccttctgccgcgccggcaaatacaacctgtgcccg
gacatggtcttcgccgccacgccgccgtaccacggcaccctgacgggcctgtgggcggcg
cccgccgacttctgctacaagctgccggacggcgtgtcgctgcaggagggcgcgctgatc
gagccgctggccgtggccgtccacattgtcaagcaggcccgcgtccagccgggccagtcc
gtcgtcgtcatgggcgccggccccgtcggcctgctgtgcgccgccgtggccaaggcgtac
ggcgcctccaccattgtcagcgtcgacatcgtgcagtccaagctcgactttgcgcgcggc
ttctgctcgacgcacacgtacgtctcgcagcgcatctcggctgaggacaacgcaaaggcc
atcaaggagctggcgggcctgcccggcggcgccgacgtcgtgattgacgccagcggcgcg
gagccgtcgatccagacgagcattcacgtcgtccgcatgggcggcacgtacgtccagggc
ggcatgggcaagagcgacatcacgttccccatcatggccatgtgcctcaaggaggtgacg
gtccggggctcgttccgctacggcgccggcgactacgagctggcggtcgagctggtccgg
acggggcgggtggacgtcaagaagctgattacgggcaccgtcagcttcaagcaggcggag
gaggcgttccaaaaggtcaagtctggggaggccatcaagattctgattgccgggcccaac
gagaaggtgtaa

DBGET integrated database retrieval system