KEGG   Trichoderma reesei: TRIREDRAFT_82235Help
Entry
TRIREDRAFT_82235  CDS       T02991                                 

Definition
(RefSeq) glycoside hydrolase family 31
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tre  Trichoderma reesei
Pathway
tre00052  Galactose metabolism
tre00500  Starch and sucrose metabolism
tre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TRIREDRAFT_82235
   00500 Starch and sucrose metabolism
    TRIREDRAFT_82235
Enzymes [BR:tre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TRIREDRAFT_82235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18489439
NCBI-ProteinID: XP_006969552
JGI: Trire2_82235
UniProt: G0RWC5
LinkDB All DBs
Position
Unknown
AA seq 891 aa AA seqDB search
MVYWKALLYAGLASAAALFKKDNATAAGLDQCPGYKASNVRVTATGVTADLTLAGAACNV
YGTDLPHLTLQVTYQTEDRIHVLIQDQGNQVYQVPESVFPRPGGSVWSQTSKLKFSYTAN
PFSFKITRAKTGEVIFDTSAASLVFESQYLRLRTSLPANPNLYGLGEHSDSLRLETTNYI
RTMWNQDSYGIPSHANLYGTHPFYLEQRATGAHGVFFLNSNGMDIIINKDASGNQYLEYN
TIGGVFDFYFVAGPTPVAAVQQYGEFAGFPTMQPYWGLGFHQCRYGYRDAFDVAEVVQNY
SLAGIPLETMWTDIDYMDRRRVFTLDPDRFPLSKMRELVDHLHAHDQHYVVMVDPAVAYQ
NYPPANQGLEDNVFMLRSNGSVWIGVVWPGVTVFPDWFSANITRYWNGQFQTFFDADTGL
DIDALWIDMNEPSNFPCNFPCDDPYKAAIGYPPAPPPVRAPPRPLPGWPIRNIVPNNKPS
SGRGDQKGLPGRDLLYPKYAIHNKAAYQDSWNADKGGISNHTVNTDLIHQNGLAMYDTHN
LYGTMMSSASRDAMEARRPGLRPLVITRSTFAGAGSKVGHWLGDNMSQWSYYTVSIRTML
AFTSLFQFGFVGSDVCGFGGNTNEELCARWASLGAFNTFYRNHNDYGNIGQEFYRWPSVA
SAAKKAIDIRYRLLDYIYTALWRQSTDGTPAVSPMFFQYPEDPATWGLELQFFFGPGLVV
APVTQQGSTSVNVYLPSGVFYDWYTHARIDGGATNHAITGVDITSIPLFIRGGAILPLRV
KSANTTTELRKQNFELLIALDASGSASGELYLDDGVSIHQRATTHVTFTYKKGIFILGGS
FSLRVPFLISKVTILGGRPSAAAKSSSAGGSNSESFDVHLPFTGPASVRIG
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggtctactggaaggctctcttgtacgcggggctcgcgtctgccgcggccctgttcaag
aaagataatgccacggccgccggcctggaccaatgcccgggctacaaagcgtccaatgtt
cgcgtcacggcgactggtgtgacggccgacctgacgctggccggcgctgcctgcaatgtc
tatggaacagaccttccgcacctcactctgcaggtcacctaccagactgaggaccgcatc
catgttctcattcaggaccagggcaaccaggtctaccaggtccccgagtccgtcttcccc
cgcccgggaggctcagtctggtcccagacgagcaagctcaagttcagctacacggcgaat
cccttctccttcaagatcacccgcgccaagactggcgaggtcatcttcgacacctcggcg
gcgtctctcgtcttcgagtctcagtacctccgcctccggaccagcctgcctgcaaatccc
aacctgtatggcctgggagaacattctgattctctgcgcctggagacgaccaactacatc
cgcacgatgtggaaccaggacagctatggcattcccagccacgccaacctctacggaact
cacccgttctacctggagcagcgagccactggtgctcacggtgtcttctttctcaactcc
aacggcatggacatcatcatcaacaaggacgcctccggcaaccagtatctcgagtacaac
accattggcggcgtttttgacttttactttgtcgccggccctacgcccgtcgcggctgtg
cagcaatatggcgagtttgcgggcttcccaaccatgcagccatactggggcctaggcttc
caccagtgcagatacggataccgggacgcctttgatgtcgccgaagttgtccaaaactac
agcttggccggcattcccctggagaccatgtggacggatattgattacatggaccgccgc
cgcgtcttcaccctcgacccggaccgcttccccctgtccaagatgcgagagcttgtcgac
cacctgcacgcgcacgaccagcactacgtcgtcatggttgatccggccgttgcctatcag
aactacccgcctgccaaccagggcctcgaggacaacgtattcatgctgcggtctaacggc
tccgtgtggatcggcgtggtgtggcccggcgtcaccgtctttcccgactggttctcggcc
aacatcacgcggtactggaacggccagttccagaccttcttcgacgccgacacgggcctg
gacattgacgccctgtggatcgacatgaatgagcccagcaactttccgtgcaacttcccc
tgtgacgatccctacaaggccgccatcggctatcctccggccccgccgccggtccgtgcc
ccgcctcgtccgctgcccggctggcccatccgcaacatcgtccccaacaacaagcccagc
agtggcaggggggaccaaaaagggcttcccggccgcgacttgctgtatcccaagtacgcc
atccacaacaaagccgcctaccaggactcgtggaacgccgacaagggcggcatctccaac
cacacggtcaacacggatctgatccaccagaacggtcttgccatgtacgacacgcacaac
ctctacggcaccatgatgtcgtcggcctcccgcgacgccatggaggctcgccgccccggc
ctccgccccctggtcatcacgcgcagcactttcgcgggcgcgggctccaaggtcggccac
tggctgggcgacaacatgtcgcagtggagctactacaccgtgtccatccggacgatgctg
gcgttcacgtccctcttccagtttggcttcgtgggctccgacgtgtgcggcttcggcggc
aacaccaacgaggagctgtgcgcgcgctgggcgtcgctgggcgccttcaacaccttctac
cgcaaccacaacgactatggcaacattggtcaggagttttaccgctggccgtccgtcgcc
agcgccgccaagaaggccattgacatccgctaccgcctgctcgactacatctacacggcg
ctgtggcgccagtccaccgacggcacgcccgccgtcagccccatgttcttccagtacccc
gaggacccggctacctggggcctcgagctgcagttcttcttcgggccgggcctcgtcgtc
gcccccgtcacgcagcaggggtccaccagcgtcaacgtctacctgcccagcggcgtcttc
tacgactggtacacgcacgcccgcatcgacggcggcgcgaccaaccacgccatcaccggc
gtcgacatcacctccatcccgctcttcatccgcggcggcgccatcctgcccctccgcgtc
aagtccgccaacaccaccaccgagctgcgcaagcagaactttgagctcctcattgcgctc
gacgcctcgggctctgcctcgggcgagctgtacctcgacgatggcgtgtccatccaccag
cgcgccacgacccacgtcaccttcacgtacaagaagggcatctttatcctcggcgggtct
ttcagcctgagagtgccattcctcatttccaaggtgactatcctgggcggcaggccctct
gccgctgccaagtcgagcagcgccggaggcagcaacagcgagtcgtttgacgttcacttg
ccgtttactggtccggcgtctgtgaggatcggttag

DBGET integrated database retrieval system