KEGG   Thermococcus radiotolerans: A3L10_03610Help
Entry
A3L10_03610       CDS       T05177                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
trl  Thermococcus radiotolerans
Pathway
trl00030  Pentose phosphate pathway
trl01100  Metabolic pathways
trl01120  Microbial metabolism in diverse environments
trl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:trl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3L10_03610
Enzymes [BR:trl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3L10_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASJ14269
LinkDB All DBs
Position
complement(656352..658211)
Genome map
AA seq 619 aa AA seqDB search
MYGYHNRIARVNLSTGRVTYEELPDEMIRKFIGGKGLGYYLIYREVPPGTDPLSPANKFI
FAPGGLTGLIPGSSKVIAVSKSPETGLISDSSGGDAFGPKLKGHFDALIIEGKAEEPVYL
YVHDGKVEIRNAKHLWGKGNYEVARELWREHPTSSVALIGPAGEKLSRIANVIYDTERAS
GRGGLGAVLGSKRVKAVVVEPGEKPPVANPEEFQRLWQEFYDHFATDPKYEHSRNYGTSD
GLRSSASLGMSPAYNFSRPHIPDELASKLAGDEVKKYEVEPEWFVHGKSCPIKCARYVEV
EYKGRKIRVKPEYESIAMLGAATGVFNFPAVAYFNWLVNNLGLDSIATGATIGWLFEIVE
RGLITEDEIGFPVKGFGDEEAEERLIKLMAERRGIGAILADGVKRACERLGRGCELAVHV
KGMESPAWDPRGRRTYALSYATADVGASHLRGWPRPHQLPNQGPARELVPSMIEGRDESY
ITDMLGTCKFVSYKMEDLARFYSLATGEEWTVEKLRKVAQAVESIARIHDALDWVTPPLD
DTIPPRWWEPEPDGPAEGNAAFIDYNDFLEARKEFYRLRGWHEELGVPLPETMEELGYPE
FKDDAERALEVVKKRMGLI
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggctaccataacaggatagcccgggttaacctgagtactggaagggtgacgtat
gaggaactgcccgacgagatgataaggaagttcatcggcgggaaggggctcggctactac
ctgatttaccgggaggttccgcccggaaccgacccgttaagcccggccaacaagttcatc
tttgcgccgggtggactgacgggcctcatacccggctcgagcaaggtcatagccgtcagc
aagagcccagagacggggctcataagcgactccagcggcggagacgccttcgggccgaag
ctcaaggggcacttcgacgccctgataatcgaaggtaaagctgaggagccggtttacctc
tacgtccatgatggaaaggtcgagattaggaacgcaaagcatctctggggtaaaggaaac
tacgaggtcgccagagaactctggagggagcaccctacttcgagcgtggcactcatcggg
ccggccggagagaagctgagcaggatagccaacgtcatctacgacacggagagggcgagc
ggaaggggcggccttggggccgttcttgggagcaagcgggttaaggcggtcgtcgtcgaa
cccggtgagaagccccctgttgccaaccccgaggagttccagagactctggcaggagttc
tacgaccacttcgccaccgatccgaagtacgagcacagtagaaactacggcacgagcgat
gggctgaggagctcggcttcccttggaatgagtcctgcgtacaacttctcaaggccccac
atacccgatgagttagcgagcaaattggctggagacgaagtcaagaagtacgaggtcgag
ccggaatggttcgtccacggcaagagctgtccgataaagtgcgcccgctatgtggaggtc
gagtacaagggcagaaaaatccgcgtcaagcctgaatacgagagcattgccatgctcgga
gccgcgaccggagtgttcaacttcccggcggtggcgtacttcaactggctcgtcaacaac
ctcggcttggatagcatagcgaccggagcgaccatcggctggctctttgagatagtggag
aggggcttaatcacggaggatgaaataggcttcccggttaaaggcttcggtgacgaggaa
gcggaggagaggctcatcaagctgatggccgagaggaggggaattggggcgattttagcg
gacggcgttaagagggcctgcgagaggctcggcaggggctgcgaactggcagttcacgtg
aagggcatggaaagccccgcttgggacccgcgcggaaggaggacctacgccctcagctac
gccactgccgacgttggggcgagccacctgaggggctggccgaggccgcaccagctgccc
aaccaggggcctgctagggaactcgtcccgtcgatgatagagggcagggacgagagctac
ataacggacatgcttggaacgtgcaagttcgtttcctacaagatggaggatctggcgagg
ttctactccctagcaaccggcgaggagtggacggtagagaagctcaggaaggtcgcgcag
gcagttgagagcatagcaaggatacacgatgccctcgactgggttactcctccgctcgac
gatacgattccaccgcgctggtgggagcccgagccagacgggcctgcggagggcaacgcg
gccttcatagactacaacgacttccttgaagcgaggaaagaattctaccggctgaggggc
tggcacgaggagctcggcgtcccgctgccggagacgatggaggagctcggctatccggag
ttcaaggatgatgcggagagggctttggaggtcgtgaagaagaggatggggcttatctga

DBGET integrated database retrieval system