KEGG   Thermococcus radiotolerans: A3L10_05570Help
Entry
A3L10_05570       CDS       T05177                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
trl  Thermococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:trl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3L10_05570
Enzymes [BR:trl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A3L10_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ASJ14625
UniProt: A0A2Z2MXP5
LinkDB All DBs
Position
complement(1015899..1017041)
Genome map
AA seq 380 aa AA seqDB search
MVSSSFRAMLLKLGVPEDRLAVLEGKGGVVEGEFEGIRYVRFRDSAKGFRRGTVVFENGD
VVLGFPHIKRVVQLERGIKRVFKNKPFYVEEKVDGYNVRVVKVRDRVLALTRGGFVCPFT
TERILDFVNEEFFRDYPNLVLAGEMAGPESPYIVEGPPYVKEDIEFFLFDIQEKGTGRSL
PVEERLKLAEEYGIRHVETFGLYDRSKIEELHELIERFSRERREGIVMKTPDMKRIAKYV
TPYANINDIRIGSHIFFDLPHGYFMGRIKRLAFYLAEKHVKGEEFDEYAKALGKAILRPF
VESIHEVANGGEVEEVFTVRVKNISTAHRMVTHFERLGVKIHIEDIEDLRNGYWRITFKR
VYPDATREMRELWNGLAFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtaagctcaagctttagggcaatgcttctcaagcttggcgttcctgaggacaggctg
gccgttctcgagggtaagggtggagtggtggagggtgaattcgaaggcatcagatacgtt
cgctttcgcgattctgccaagggcttccggcgtggaaccgttgtctttgagaacggtgac
gttgtcctggggtttcctcacataaagcgcgttgtccagctggagagggggataaagagg
gtcttcaagaacaaacccttctacgtcgaggagaaagtggacggctacaacgtccgtgtc
gtcaaggttcgagacagggttctcgccctcaccaggggaggttttgtctgccccttcacg
actgagaggatacttgacttcgtgaacgaggagttcttcagggactaccccaacctagtc
ctggccggcgagatggccgggcccgaaagcccgtacatcgtggaggggccaccctacgtg
aaggaggacattgagttcttcctctttgacatccaggagaagggaacggggaggagcctt
ccggtggaggagaggctcaagcttgccgaggagtacggcattcgtcacgttgaaactttc
ggcctctacgaccgttcaaaaattgaagagctgcatgagctgatcgaaaggttcagccgg
gagaggagagagggtatcgtcatgaaaacgcccgacatgaagagaatcgcgaaatacgta
acgccatacgccaacattaacgacatccggataggttcccacatattctttgacctgccg
cacggctacttcatggggaggattaaacgcctcgcgttctacctggccgaaaagcacgtc
aagggtgaggagttcgacgaatatgctaaagcccttggaaaggccatcctccggccgttt
gtcgagagcatccacgaggtcgccaacggcggcgaggttgaggaggtcttcacggtgagg
gtgaagaacataagcaccgcccacaggatggtgacccacttcgagaggctcggcgtgaaa
atccacatcgaggacatagaggacctcaggaacggctactggcggataaccttcaagagg
gtctatccagacgccacacgcgagatgagggagctgtggaacgggctggcgtttgtggat
taa

DBGET integrated database retrieval system