KEGG   Treponema sp. OMZ 838: JO41_01385Help
Entry
JO41_01385        CDS       T03454                                 

Definition
(GenBank) molecular chaperone Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
trm  Treponema sp. OMZ 838
Brite
KEGG Orthology (KO) [BR:trm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:trm03110]
    JO41_01385
Chaperones and folding catalysts [BR:trm03110]
 Heat shock proteins
  HSP33
   JO41_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AIW88610
UniProt: A0A0A0WZQ8
LinkDB All DBs
Position
301897..302859
Genome map
AA seq 320 aa AA seqDB search
MIYAPIDDTALQQHLDKLEKDELHIFTADDGLFRGGLFHGTRFVNRIRAQHRLGILETLV
LGQAGLCAALMIQTMKGRETLQLRYETDGPATGFSVEADSRGFVRGYLLQNPIPIETPLE
SWDLAPFLGNGTLTVTRFPEADHAAGREPHRGIVEIKYRNIAKDLAWYFQQSEQLYTAFN
TSIRFDSIGRVVGAGGFFIQRMPTEGGTRRGKQAKTEEEIEDAVTRMERAFTACPPLGDW
FSEGGNCEDIIFGLLREFNPQAVAARNIAFDCPCSKEYYLEALQKLSEAERKNLKETADD
PLEIVCRNCSSVYHIPLAEL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatatacgcacctattgacgacacggcgctgcaacagcaccttgataaacttgaaaaa
gatgaactccatatctttactgccgacgacggcctgttccgcggagggcttttccacggc
acgcggttcgtaaaccgaatacgtgcacagcaccggctgggaatcctcgaaacccttgtg
ctcggacaggcaggcctctgtgcagcactgatgattcaaacgatgaaagggcgcgaaaca
ctccagctgcgctatgaaacggacggccctgcaaccggcttttcagtagaagcagactcg
cgaggctttgtgcgcggctatcttctgcaaaatcccataccgattgaaactccgcttgaa
agctgggatctcgccccctttttaggaaacggcacacttaccgttacccgctttccggag
gcagatcatgctgccgggcgggaaccacatcgcggtattgtcgaaattaaataccggaat
atcgcaaaagaccttgcgtggtattttcagcaatcggaacagctctatacggcctttaat
acgagtatcaggtttgacagcattggcagagtagtcggcgccggaggcttttttatccaa
cggatgccgacggaaggaggaactcgccgcggaaaacaggcaaaaacggaagaagaaatt
gaagatgccgttacccgtatggaacgggcgtttaccgcctgtcctccgctcggcgattgg
ttcagtgaaggcgggaactgcgaagatatcattttcggcttactgagagagttcaatcct
caagcggttgcagcacggaacatagccttcgattgcccatgttcaaaagagtattatctg
gaagcattgcagaagctgtcggaagctgaacggaaaaacttaaaagaaacagcagacgat
ccgcttgagattgtctgccggaattgctccagtgtctaccatattccgcttgccgaacta
taa

DBGET integrated database retrieval system