KEGG   Treponema sp. OMZ 838: JO41_11330Help
Entry
JO41_11330        CDS       T03454                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
trm  Treponema sp. OMZ 838
Pathway
trm00010  Glycolysis / Gluconeogenesis
trm00260  Glycine, serine and threonine metabolism
trm00680  Methane metabolism
trm01100  Metabolic pathways
trm01110  Biosynthesis of secondary metabolites
trm01120  Microbial metabolism in diverse environments
trm01130  Biosynthesis of antibiotics
trm01200  Carbon metabolism
trm01230  Biosynthesis of amino acids
Module
trm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
trm_M00002  Glycolysis, core module involving three-carbon compounds
trm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:trm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JO41_11330 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    JO41_11330 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JO41_11330 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:trm04131]
    JO41_11330 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trm04147]
    JO41_11330 (gpmA)
Enzymes [BR:trm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     JO41_11330 (gpmA)
Membrane trafficking [BR:trm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    JO41_11330 (gpmA)
Exosome [BR:trm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   JO41_11330 (gpmA)
  Exosomal proteins of melanoma cells
   JO41_11330 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIW90328
UniProt: A0A0A0X1K0
LinkDB All DBs
Position
2394008..2394751
Genome map
AA seq 247 aa AA seqDB search
MKLVLIRHGESEWNKLNLFTGWTDVELSEKGVEEAKEGGKALAAAGFDFDICYTSYLKRA
IHTLQFVLDELDRNWLPVVKTWKLNERHYGDLQGLNKAETAEKYGEAQVKIWRRSFDIAP
PVLAENDTRCPYLQTAYRGIDKAELPRTESLKDTIARAVPYFESVIKRDMLAGKRVLIAA
HGNSLRALIKYFEHLSDEEIIQVNLPTGVPLVYEFDTNFNVVSKAYLGDQEKINAKINAV
ANQGKAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtgcttatacggcatggcgaaagtgaatggaacaagttgaacctgtttacc
ggttggactgatgtggaactgtcggaaaagggcgtagaggaagcaaaggaaggcggaaag
gctcttgccgcagccggttttgactttgatatctgctatacctcatacttaaaacgggcg
attcatacgctgcaattcgtattggatgagcttgaccgcaactggcttcccgtcgttaaa
acatggaagctgaacgaacgacattacggcgatctgcaaggattgaacaaagctgaaacg
gctgaaaaatacggagaagcgcaggtaaagatttggcgccgttccttcgatattgcgccg
cccgtccttgccgaaaacgatacacgctgtccgtatctccaaactgcataccgcggcatc
gacaaggcggaactgccccgtaccgaaagcttgaaagataccattgcacgggctgttccg
tatttcgaatcggtaattaaaagagatatgctggcaggtaagcgcgtactgattgccgcc
cacggtaattcgctccgtgcgcttattaaatacttcgagcatctcagcgatgaagagatt
attcaggtgaatttgccgacgggcgttccgcttgtctatgaatttgatactaattttaat
gtggtgagtaaggcctatttgggagatcaggaaaaaatcaatgccaagatcaacgccgtt
gcgaatcaaggcaaggcgaaataa

DBGET integrated database retrieval system