KEGG   Thermomicrobium roseum: trd_1060Help
Entry
trd_1060          CDS       T00845                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tro  Thermomicrobium roseum
Pathway
tro00620  Pyruvate metabolism
tro00680  Methane metabolism
tro01100  Metabolic pathways
tro01120  Microbial metabolism in diverse environments
tro01200  Carbon metabolism
Module
tro_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    trd_1060 (ppc)
  Energy metabolism
   00680 Methane metabolism
    trd_1060 (ppc)
Enzymes [BR:tro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     trd_1060 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 TP6A_N
Motif
Other DBs
NCBI-ProteinID: ACM05187
UniProt: B9L0J1
LinkDB All DBs
Position
complement(1032709..1035495)
Genome map
AA seq 928 aa AA seqDB search
MAGGRALDDERSAKALRAEPIEGLRNEVNLLGALLGDVLREQGGTELFDLVEWARLQSIT
GRTVGNMSDAFRGLLARLEEASDEEIFGLVRAFGIFFHLINLAEQHHRVRTLRQRERQER
ALHESLEEAFLTLRDRGVEPDRVKELLDDLLLFPVLTAHPSETRRRTVLQRLAALGQLIQ
QLDDTRLSPRERDWLFDRLREEITLLWQTAETRLARPTPLDEVRSTIAILAGPIYDVVPF
FRRALRRAILRAYPELTSEALWNRLPIRIGSWVGGDRDGNPAVTAAVTEATARLMREAIL
RRYLEEVVDLRRALSVSARLRGASDELMATIDQERERLGFAPVRAWADEPYRRMLGLIEE
RLRRTERGEQGGYAGPEEFATHLKVMADSLRQHEGHWIADGRLADLIARVDVFGFHLAEL
EIRQDAARYREALAELFALVGCAGYEAMPSDEREHLVLTRLEQGVFGLPRGALSPDTREV
LATFDAIGRIQRLSGERACHTVIVSMTREPADVLGTVVLAREAGLIDFATDGAVRHCRID
VVPLFEQIAELDRCDQILARLLANPIYRTVVRLRGNQQEVMLGYSDSNKDGGYVSSNWRI
YRAQERLAEVARQFGAQLRLFYGRGGAIGRGGGPMGRAIRARPAAARRPVLKTTEQGEVI
FARYSDPAIALRHWEQMTHASIGSLGSDPDPSMPESWYRMMEQLATWSQEAYERLVKDEP
TFVRFFTSATPFPELASLNLASRPVARRGSPESGLCFADLRAIPWVFSWTQTRVNLPGWY
GLGTALERALAAGEESTLREMYYRWPFFEMLLDNAQISLATADMLIAECYATLAGDDGWI
AERIAEEYQRAVRTILAVTGQCELLERSPILARLVRLRNPYVDVLHACQIVLLRRYRAGA
GKGERQSRLLDAIHHSINAIAAGLQTTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggacgagcgctcgacgatgagcggtcagcgaaggccttgagagctgagccg
atcgaggggctgcgcaacgaggtcaacctgctcggtgctctcttgggagacgtgctccgc
gaacaggggggtactgagctcttcgacctcgtggagtgggcacggcttcagtcgatcacg
gggcgaactgttggaaacatgagtgatgcctttcgtgggttactcgcgcggctcgaggaa
gcgagcgacgaggagatcttcggactcgttcgtgcgttcggtatcttctttcacttgatc
aatctggccgagcagcatcaccgtgtccgaacgctgcgccagcgtgaacgacaagaacgg
gctttgcacgaatcactggaagaagcgttcctgacgttgcgcgaccgtggtgtcgagccg
gatcgagtgaaggaactgctcgacgacttgttgctctttcccgtcctcacggcgcatccc
tcggagacgcgacgacggacggttctccaacggctggctgcactcgggcagttgatccaa
cagctggacgatacgcgactgtcgccgcgggagcgtgattggctcttcgatcgcctgcgc
gaggaaatcacgcttctctggcagacggcggaaacgcgcctggcacggccgacaccgctg
gatgaggtacggagcacgatcgcgattctcgctggtccgatctacgatgtcgttcccttc
ttccggcgtgcgctccggcgagccattcttcgggcatatccagaactgacgagcgaagcg
ctttggaacaggctaccgatccgaatcggcagctgggtcggaggcgatcgtgacggcaac
ccggcggtcacggcagccgtcaccgaggcgacggctcggctgatgcgcgaggctattctt
cgacgctacctcgaggaggtcgtcgatctccggcgagcgctgagcgtctcggcacgtttg
cgcggtgcctccgatgagttaatggcgacgatcgaccaggagcgggaacgactcggtttt
gcgccagttcgagcatgggctgacgagccgtatcggcggatgctcgggctcatcgaggag
cgcttgcggcgaactgagcgcggagaacagggaggctatgcgggtcctgaggaatttgcg
actcacttgaaggtgatggctgactctcttcggcagcatgaagggcactggatcgcggat
ggccggctcgctgacttgatcgcacgcgtggacgttttcggcttccatcttgccgaactg
gagattcgtcaagatgcagctcggtaccgcgaagcgctcgccgagctctttgcgttggta
gggtgcgccggctatgaggcgatgccgagcgacgagcgggagcatctcgtgctgactcgc
ctcgagcaaggtgtctttggtcttccgcggggagcgctcagtcctgacacacgagaagtt
ctcgctaccttcgacgcgatcggacggatccagcggctgagcggcgagcgagcttgccac
acagtgatcgtctcgatgactcgcgagccggccgacgtgctcggtacggtcgtgctggca
cgcgaggcggggctcatcgattttgcgacggacggtgccgttcggcattgccggatcgac
gtggttccgctgttcgagcagatcgccgagctggatcgttgtgaccagattctcgcgcgc
ctgttggccaatccgatctatcgcacggtcgtgaggctacgcggtaaccagcaggaggtg
atgctcggctactccgacagtaacaaagatggagggtatgtttcctccaattggcgcatc
tatcgtgcgcaggagcgtttggctgaggttgcacgacagttcggtgcccagctccgcctc
ttttacggtcgtggtggagcgatcggccgaggaggaggcccgatgggacgggctattcgt
gcccggccagcagcagctcgtcgacccgttctcaagacaaccgagcagggagaagtgatc
tttgcccgctatagcgacccggccatcgcactgcggcattgggaacaaatgacgcatgca
tcgatcggttctctcgggagcgatcctgatccgtcgatgcccgaatcgtggtaccgcatg
atggagcagttggcgacttggtcgcaagaggcctacgagcggctggtcaaggacgagcca
acgttcgtccgcttcttcaccagtgcgacgcctttcccagaactcgctagtttgaacctc
gcgtcgcggccagtcgcacgccggggtagtcccgaaagcgggctttgctttgctgatctg
cgggcgatcccgtgggttttcagctggacacaaacgcgtgtgaatctgccaggatggtac
ggactgggaacagcgctcgagcgcgcgctggctgcgggggaggaatccacactccgcgag
atgtattaccgctggccgttcttcgaaatgctgctcgataacgcgcaaatcagcctcgcg
acagcggacatgctgatcgccgagtgctacgcgacgctcgccggggacgacgggtggatc
gccgagcggatcgccgaagagtaccagcgagcggtgcggaccattttggcagtcaccggt
caatgcgaactcttggagcgttcgccgatcctcgcccgactggtgcggttacgcaatccg
tacgtcgatgtcctgcatgcgtgtcagatcgtcttgttacgtcggtaccgggcaggtgcc
ggcaagggcgagcgccaatcgcgcctcttggatgccatccatcacagcatcaatgcgatc
gcagcagggttgcagacgaccggttga

DBGET integrated database retrieval system