KEGG   Thermomicrobium roseum: trd_1519Help
Entry
trd_1519          CDS       T00845                                 

Gene name
lysX
Definition
(GenBank) Lysine biosynthesis enzyme LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
tro  Thermomicrobium roseum
Pathway
tro00300  Lysine biosynthesis
tro01100  Metabolic pathways
tro01210  2-Oxocarboxylic acid metabolism
tro01230  Biosynthesis of amino acids
Module
tro_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:tro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    trd_1519 (lysX)
Enzymes [BR:tro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     trd_1519 (lysX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATPgrasp_ST ATP-grasp_3 CPSase_L_D2 ATP-grasp_5 R2K_3 ATP-grasp R2K_2
Motif
Other DBs
NCBI-ProteinID: ACM05516
UniProt: B9KZP9
LinkDB All DBs
Position
complement(1499443..1500327)
Genome map
AA seq 294 aa AA seqDB search
MSAPRIGVLLSHVREEEKLLLRALSERGAEVVRLYDRQLVFDLTDERSWPQVDLVLDRCM
AHSRGQVALRLFESAGVPTINRSQATAIADDKVLTTRLLAAAGIPTLRTLVAFDVESALA
ALERLGYPAVIKPVTGSWGRLLARVNSPAAARAVLQHKRSLGSFHHGVFYLQEYVDKPGR
DVRVFVVGDRVVAASYRQADHWVTNVARGAVSYPCPVTPELADLALRAVQTIGLEIAGVD
LVETADGLEVLEVNGGVEFKGLMRTTHIDVAGLIADYVLARATRGASPAIALSR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcaccgcggatcggtgtcttgctctcgcatgtccgggaagaggagaagctgctc
ctgcgtgcgctcagcgagcggggagccgaggtcgtgcgcctctacgaccggcagctggtc
ttcgatttgacggacgagcggagctggccccaggtcgatctggtactcgatcgctgcatg
gcgcatagccgggggcaggtcgcgctacgcctcttcgagtcggctggcgtcccgacgatc
aatcggagccaggcgacggcgatcgctgacgacaaggtgctgaccacgcggttgctcgca
gcagctggtatcccgaccctccgcacgctcgtcgccttcgacgtcgagagtgcgctggca
gcgctggaacggctcggttatccagctgtcatcaagccggtgaccggttcctggggacgg
ctcctcgctcgcgtcaactcaccagcggcagcccgcgccgtgctgcagcacaagcggtcg
ctcggctctttccaccacggagtcttctatctccaggaatacgtggacaagccgggccgc
gacgtgcgcgtcttcgtggtcggtgaccgggtggtggctgcttcctatcgtcaggccgac
cactgggtgaccaatgtcgctcgcggggcggtttcttatccctgccctgtgacacctgaa
ctcgccgatctcgccttgcgggctgtccagacgatcggtttggagatcgccggagtcgat
ctcgtcgagactgccgacggactcgaggtgctggaagtcaatggtggtgtcgagttcaag
ggcctgatgcggacgactcatatcgatgtcgccggtctcatcgccgattacgtgctcgcg
cgggcgacgcgaggtgcgtcgcccgcgatcgcattgagccggtga

DBGET integrated database retrieval system