KEGG   Thermomicrobium roseum: trd_1572Help
Entry
trd_1572          CDS       T00845                                 

Definition
(GenBank) aldh
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
tro  Thermomicrobium roseum
Pathway
tro00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:tro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    trd_1572
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     trd_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC Bclx_interact
Motif
Other DBs
NCBI-ProteinID: ACM05208
UniProt: B9L079
LinkDB All DBs
Position
1556280..1557779
Genome map
AA seq 499 aa AA seqDB search
MADFKNYIDGKWVEAKSGATYERRNPATGELIGTYARSGPEDVAAAVEAAKAAFDRWRKL
PAPKRGEILFRVGQLLIERKEQLAREMTEEMGKVLTEARGDVQEAIDMTFYMAGEGRRLW
GQTTPSELPHKWNMTQRRPIGVVGLITPWNFPIAIPAWKIMPALICGNTVVFKPASYTAR
SAVRLVQIFEEAGLPPGVLNLVLGTGETVGTALVQHPDVALISFTGSNEVGQQVAVECAR
LGKRVSLEMGGKNAIIVMDDANLRLALDGIVWSAFGTSGQRCTAASRVIVHEAVFRELAD
QLDARVSRLKLGNGLDPTTDVGPVVSESQLERVHRYVQIGVEEGAQILTGGQIARDGDLA
RGHFHQPTIFVDVRPEMRIAQEEIFGPVTALIRVRSLEEAIAVCNGVRYGLSASIFTRDI
DKAFRAIEDVHTGIFYVNAGTIGAEIHLPFGGTKATGNGHREAGQAALDVFSEWQSIFID
YSGRLQRAQIDVEQLTADD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcaagaactatatcgatggcaagtgggtcgaggcgaagagcggtgccacg
tacgaacgccgcaaccccgcgacgggcgaactcatcggcacctacgccaggagcggcccg
gaggacgtcgccgcggcggtggaggcggccaaggcagccttcgatcgctggcgcaagctc
cccgcgcccaagcgcggagagatcctcttccgtgtcggccagctcctcatcgagcgcaag
gaacagctggcacgcgagatgaccgaggagatgggcaaggttcttaccgaggcccgaggc
gacgtccaggaagcgatcgacatgaccttctacatggcgggtgagggtcgccgcctctgg
ggccagacgactccttccgagctcccccacaagtggaacatgacgcagcgtcggccgatc
ggcgtggtcgggctcatcacgccgtggaacttcccgatcgccataccggcctggaagatc
atgccggcgctgatctgcggaaacacggtcgtcttcaagcccgccagctacacagcgcgc
tcggctgtccgactcgtccaaatcttcgaggaagccggtttgccgcccggcgtgctcaac
ctcgtcctcggaaccggcgagacggtggggaccgcgctcgtccagcacccggacgtcgcg
ctcatctccttcaccgggtccaacgaggtcggccagcaggtcgccgtcgagtgtgcgcga
ttgggcaagcgcgtttcgttggaaatgggtgggaagaacgccatcatcgtgatggatgac
gcgaacctccggctcgccctggacgggatcgtctggagtgctttcgggacctccggccag
cgctgcacggcagccagccgcgtcatcgtgcacgaggcggtcttccgcgagctcgccgat
caactcgacgcgcgggtgagccggctcaagctcggcaacggcctcgaccccacgaccgac
gtcggcccggtcgtgagcgagagccagctcgagcgtgtccaccgctacgtccagatcggc
gtcgaagaaggggcgcagatcttgaccggtggacagatcgcgcgcgacggggacctggca
cgcggccacttccaccagccgaccatcttcgtcgatgtgcgccccgagatgcggatcgcc
caggaagagatcttcggaccagtcaccgcgctcatccgggtgcgcagcctcgaggaagcg
atcgcggtctgcaacggcgtgcgctatggtctctcggcctcgatcttcacccgcgacatc
gacaaggcattccgtgccatcgaggacgtccataccggcatcttctacgtcaatgccggt
accatcggagcggaaattcatctcccgttcggcggtaccaaggcgaccgggaacgggcac
cgcgaggcagggcaggctgcactcgacgtcttcagcgagtggcagtcgatcttcatcgac
tacagcggtcgcctccagcgcgctcagatcgacgtcgagcagctcactgctgacgactga

DBGET integrated database retrieval system