KEGG   Thermotoga sp. RQ2: TRQ2_0275Help
Entry
TRQ2_0275         CDS       T00706                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00270  Cysteine and methionine metabolism
trq00330  Arginine and proline metabolism
trq00410  beta-Alanine metabolism
trq00480  Glutathione metabolism
trq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TRQ2_0275
   00330 Arginine and proline metabolism
    TRQ2_0275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRQ2_0275
   00480 Glutathione metabolism
    TRQ2_0275
Enzymes [BR:trq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     TRQ2_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ACB08634
UniProt: A0A0F6AJL2
LinkDB All DBs
Position
259545..260426
Genome map
AA seq 293 aa AA seqDB search
MKEFERDLQPRQHLWYFEYYTGNNVGLFMKINRMIYSGQSDIQRIDIFENPDLGVVFSLD
GITMTTEKDEFMYHEMLAHVPMFLHPNPKKVLIIGGGDGGTLREVLKHDSMEKAVLCEVD
GLVIEAARKYLKQTSCGFDDPRTEIVIANGAEYVRKFKNEFDVIIIDSTDPTAGQGGHLF
TEEFYQACYDALKEDGVFSAETEDPFYDIGWFKLAYKRISKVFPITKVYLGFMTTYPSGM
WSYTFASKGIDPIKDFNPEKVKNFNKELKYYNEEVHVASFALPNFVKKELGLM
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaatttgaaagagatctccagccaagacagcacctgtggtacttcgagtactat
acaggaaacaacgtgggactcttcatgaagataaaccgcatgatctactcaggacagagc
gacattcagaggatagatatcttcgagaatcccgatcttggcgtggttttttcgctcgac
ggcatcacgatgaccacggaaaaggacgagttcatgtaccacgaaatgctcgcacacgtt
cccatgttcctccatccgaacccgaagaaggtgctcatcatcggcggtggagacggcgga
acgctcagagaagtcctgaaacacgacagcatggagaaggcggttctctgcgaagtggac
ggactcgtcatagaagccgcaaggaagtatttgaagcagacttcgtgcggtttcgacgat
ccaaggacagagatcgtgatcgcaaacggtgccgaatacgtgaggaagttcaagaacgag
ttcgatgtcatcatcatagactccacggacccgacggcgggccagggtgggcacctcttc
accgaagagttctaccaggcctgttacgatgccctcaaggaagacggagtcttctccgcc
gagacggaagacccgttctacgacatcggatggttcaagctcgcttacaagaggatcagc
aaggtctttcctatcacgaaggtttaccttggattcatgaccacctatccctccggcatg
tggtcctacaccttcgcctccaagggaatagacccgataaaagacttcaaccccgaaaag
gtgaaaaacttcaacaaagagctgaagtactacaacgaagaagttcacgtcgcgtccttc
gcccttccgaacttcgtgaagaaagaactcggactgatgtga

DBGET integrated database retrieval system