KEGG   Thermotoga sp. RQ2: TRQ2_0928Help
Entry
TRQ2_0928         CDS       T00706                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00010  Glycolysis / Gluconeogenesis
trq00020  Citrate cycle (TCA cycle)
trq00620  Pyruvate metabolism
trq00633  Nitrotoluene degradation
trq00640  Propanoate metabolism
trq00650  Butanoate metabolism
trq00680  Methane metabolism
trq01100  Metabolic pathways
trq01110  Biosynthesis of secondary metabolites
trq01120  Microbial metabolism in diverse environments
trq01130  Biosynthesis of antibiotics
trq01200  Carbon metabolism
Module
trq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:trq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ2_0928
   00020 Citrate cycle (TCA cycle)
    TRQ2_0928
   00620 Pyruvate metabolism
    TRQ2_0928
   00640 Propanoate metabolism
    TRQ2_0928
   00650 Butanoate metabolism
    TRQ2_0928
  09102 Energy metabolism
   00680 Methane metabolism
    TRQ2_0928
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TRQ2_0928
Enzymes [BR:trq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TRQ2_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: ACB09279
UniProt: A0A0F6AL76
LinkDB All DBs
Position
complement(962267..963445)
Genome map
AA seq 392 aa AA seqDB search
MERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIPVE
SEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPINI
HCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHGVE
PVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKVFP
EIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKIWM
FRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGLGG
RDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtcgtcgagagagtggccgtcaccggcgctgaggccgttgccaatgcgatg
agacagatagagcccgatgtcgttgcggcgtacccgatcactccacagacacctattgtg
gagtacttcgccaggttcgtcgcggacggcgttgtcaggacagaaatgattcccgtcgaa
agtgaacacagtgcgatgagcgctgtcgttggagccgctgccgcgggagcaagagcgatg
acagcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgctgcctcc
tacagacttcccattgtgatgcccgttgtgaacagagcgctcagtggtcctataaacatt
cactgtgaccacagcgacgcgatggcagaaagggattctggatggattcagctctttgcg
gaaactaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaacacgaa
gatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacggagtggaa
cccgttgagttctatcccgatgaactcgtgaagaagttcgttggagagctcaaacccatg
tatcctcttctggatactgaacaccctgtaacctggggtcctctcgatctttacgattac
tacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtgttcccg
gaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggtttgtcgaaccgtac
agaatggaagatgcagagcacgtgatggtagcactgggctccacaaacagcacgataaag
tacgtggttgatgaactgagagaagaaggctacaaagttggatctttgaaaatctggatg
ttcagaccgttcccgaaggagcagcttcaggaactcctcaacggaagaaagagtgtagtt
gtgctcgacagagctgtttccttcggagcggaagcacctctctacgaagcagtgaaatct
gcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctcggtgga
agggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacggaaacctc
atagcagatgaacagagatatcttggtctcagagagtga

DBGET integrated database retrieval system