KEGG   Thermotoga sp. RQ2: TRQ2_1324Help
Entry
TRQ2_1324         CDS       T00706                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00564  Glycerophospholipid metabolism
trq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRQ2_1324
Enzymes [BR:trq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TRQ2_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 NAD_binding_8 Trp_halogenase Pyr_redox TrkA_N FAD_oxidored Pyr_redox_3 Thi4 FAD_binding_3 HI0933_like Lycopene_cycl NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACB09668
UniProt: A0A0F6AM52
LinkDB All DBs
Position
1355389..1356828
Genome map
AA seq 479 aa AA seqDB search
MKAVVIGGGVFGSLIARELTKYDLEVTIIEKNLDVGWGVTKANSAIVHAGYDDPPESVRA
QFCASGNAMYEDLSKELDFDFKRIGSFVVAFNDEELKELERLLKQGEENGVPGLTILERD
EVLSMEPNLNPEVKYALYAPTAGITEPWMVAIAAVENAVQNGLKLVLGESVVGFEKVNGR
VKKVHTSKSEYEADIVINCAGLHADEIAKLAGAEYVPLHPRKGEYILLDKKLQGLVKRVI
FPTPTKVSKGILVLPTVDGGILLGPTAEDLPEEMKDRPITTREGLEKVREFTKKLVPSLD
FSLVVKTFSGLRPESPQKDFFIKVSETVKNFVNVMATRSPGLTAAPAVAKYVVEELIQEK
MRIPLEKKKDFKPERKRIVHYSELPLEEWRREIEKDPRAGRLVCFCNEVTEKEIVEAIRR
GARTLDGVKFRTRAMFGRCQGGFCMARILKILERELGVDMSEIKMKSENSWVVNGKVRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtcgtcataggtggcggagtgtttggttctctgatagcgcgagagttaacg
aagtacgatctagaagtgaccatcatagagaaaaatctggacgtgggctggggtgtgaca
aaggcgaattccgctattgttcacgctggttacgacgatccacctgaaagcgttcgtgca
cagttttgcgcgtcaggcaatgcaatgtacgaagacctgtcgaaagagctggattttgat
ttcaaaagaattggatctttcgtagtggcgttcaacgatgaggaactgaaagaactcgag
cgcctcctaaaacagggcgaagaaaacggcgttccaggtttgaccatcctggaaagagac
gaagttctttccatggagccgaatctgaacccagaggtcaaatatgccctctacgctccc
actgctggcatcacagaaccatggatggttgccatagcagccgtggaaaacgccgtccag
aacggattgaaactcgttcttggagaaagcgtcgttggctttgagaaagtcaacggtcga
gtgaagaaagttcacaccagcaaaagtgaatacgaagcggatatcgtgataaactgcgct
gggctccacgcagacgagatagcaaagttggccggtgcagagtacgttcccctgcatccg
agaaaaggcgaatacattctcctcgataagaaacttcagggtctggtcaaaagggtcata
ttccccacacctactaaggtctcgaaggggatactcgttcttcccacagtcgatggtgga
atccttctgggaccaactgccgaggatcttcccgaagagatgaaggacagacccataacc
accagggaaggtctcgaaaaagttcgagaattcacaaaaaaactcgtaccttccctcgat
ttctccctcgtggtgaaaaccttctcagggctgagaccggaaagtccacaaaaagacttc
ttcataaaagtgagcgagacggtgaagaacttcgtgaacgttatggcaacaagatctcct
ggtctcacagcagcgccggcggtggcaaagtacgttgttgaagagttgatccaggaaaaa
atgagaattcctcttgagaagaaaaaagacttcaaaccggaaagaaagagaatcgttcac
tattcggaacttcctcttgaagagtggagaagggaaatagaaaaagatccacgtgcggga
agactcgtttgcttctgcaacgaagtgacagagaaagaaatagtagaagccataagaaga
ggagcaaggacactcgacggtgtgaaattcagaacaagagcgatgttcgggagatgtcag
gggggcttctgcatggctcgaattctcaagattctggagagagaactcggtgtggatatg
tcggaaataaagatgaaatcggagaatagctgggttgtgaacgggaaggtgagagaatga

DBGET integrated database retrieval system