KEGG   Thermotoga sp. RQ2: TRQ2_1647Help
Entry
TRQ2_1647         CDS       T00706                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00500  Starch and sucrose metabolism
trq01100  Metabolic pathways
trq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRQ2_1647
Enzymes [BR:trq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     TRQ2_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ACB09982
UniProt: A0A0F6AMV2
LinkDB All DBs
Position
complement(1669283..1671754)
Genome map
AA seq 823 aa AA seqDB search
MSKKLPENLKHLEELAYNLWWSWSRPAQRLWRKIDPEGWEEHRNPVKILKEVSDERLEEL
SKDDDFISLYELTLERFKDYMEKEDTWFNVNYPEWDEKIVYMCMEYGLTKALPIYSGGLG
ILAGDHLKSASDLGLPLIAIGLLYKHGYFTQQIDRDGKQIEIFPDYNPEDLPMKPLKDEK
GNQVIVEVPLDSTVVKARVFEVKVGRVSLYLLDPDFEENEEKYRKICNYLYNPEPDVRIS
QEILLGIGGMKLLRALNLKPGVIHLNEGHPAFSSLERIKNYMEEGYSFTEALEIVRQTSV
FTTHTPVPAGHDRFPFDLVEKKLSKFFEGFEKKNLLMDLGKDETGSFNMTYLALRTSSFI
NGVSKLHAEVSRRMFKNVWQGVPVEEIPIEGITNGVHMGTWINREMRKLYDRYLGRVWRD
HTDLEGIWYGVDRIPDEELWQAHLRAKKRFIEYIKESVRRRNERLGIDEDVPNIDENSLI
IGFARRFATYKRAVLLLSDLERLKKILNDPERPVYVVYAGKAHPRDDAGKEFLKRIYEVS
QMPEFKNRIIVLENYDIGMARLMVSGVDVWLNNPRRPMEASGTSGMKAAANGVLNASVYD
GWWVEGYNGRNGWVIGDESVLPETEVDDPRDAEALYDLLENEIIPTYYENKEKWIFMMKE
SIKSVAPRFSTTRMLKEYTEKFYIKGLVNKEWLERKENAERFGAWKERILRNWSSVSIER
IVLEDTRSVEVTVKLGDLSPDDVLVELLIGRGESMEDLEIWKVIQIRKHRREGDLFIYSY
VNGALGHLGSPGWFYAVRVLPYHPKLPTRFLPEIPVVWKKVLG
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaagaaacttccggagaacctgaagcatctggaagaactcgcttacaacctctgg
tggagctggtcaaggcccgctcaaaggctctggagaaagatcgatccggaaggctgggag
gaacacagaaatcctgttaaaatactgaaagaagtttctgatgaaagactcgaagagctt
tcaaaagatgacgatttcatatccctctatgaactcacccttgaaaggttcaaggactac
atggagaaagaagacacctggttcaacgtgaactaccccgaatgggacgagaagatcgtc
tacatgtgtatggagtacggtttgaccaaagcccttccgatctattccggtggtcttgga
atcctcgcgggagaccatctcaaatccgcaagcgatcttggacttcctctcatagcgatc
ggacttctctacaaacatggatatttcacccagcagatcgacagagatggaaaacagata
gagattttccctgattacaacccagaggacttacccatgaagcccctgaaggatgaaaag
ggaaaccaggtgatcgtggaggttcctctcgacagtaccgttgtgaaggcacgtgttttt
gaagtgaaggtaggaagggtgagtctgtacctgctcgatccggactttgaggaaaacgag
gaaaaatacagaaagatctgcaactacctttacaacccggaacccgatgtgaggatctcc
caggagatactcctcggaattgggggaatgaaacttctcagggcgctgaacctgaaacca
ggagtcatccatctgaacgaaggacatccggcgttctcttccctcgaaaggataaagaac
tacatggaagaaggatattccttcacagaggcccttgagatcgtgaggcagacgagtgtg
ttcacaacccacacacccgttcccgctggacacgacagatttccctttgacctcgtggaa
aagaaactttcgaaattcttcgaaggattcgaaaagaaaaatcttctcatggatcttggg
aaagatgaaacaggcagtttcaacatgacgtatcttgctctgagaacatcctccttcata
aacggtgtcagcaaactgcatgcggaagtttccagaaggatgttcaaaaacgtgtggcag
ggtgttcccgtggaggaaataccgatcgaagggataacgaacggcgttcacatgggaacc
tggatcaaccgtgagatgagaaaactgtacgacagatatctcggaagggtatggagagat
cacaccgaccttgagggtatctggtacggtgttgacaggattccagatgaagaactctgg
caggctcacctgagggcaaagaagagattcatcgagtacataaaagaatcggtaagaaga
agaaacgagagactgggaatcgacgaagatgtgccgaacatcgatgaaaattcgctcatc
ataggttttgcaagaaggtttgccacttacaagagggcagttctcctgctcagcgatctg
gagagactcaagaagatcctcaacgatccagaaagacccgtttacgtggtctatgcgggg
aaggcccatccaagggacgatgcggggaaggaatttttgaaacgcatctacgaagtctcg
cagatgcctgagttcaaaaacaggatcatcgtactggaaaactacgacattggaatggca
cggctcatggtgtcgggagtggatgtgtggctgaacaacccgagaagacccatggaagca
agtggaacaagcggaatgaaggcagcagccaacggagttcttaacgcgagtgtttacgat
ggatggtgggttgaagggtacaacggcagaaacggctgggtcataggcgatgaaagcgtt
cttccagagacggaagtggacgatcccagggacgcagaagcactctacgatctcctcgaa
aacgaaatcatcccaacctactacgaaaacaaagaaaagtggatcttcatgatgaaagag
agcataaagagtgttgctccaagattcagcaccaccagaatgctcaaagaatacacggag
aagttctacataaagggacttgtgaacaaagaatggcttgaaagaaaagaaaacgccgaa
aggtttggtgcatggaaggaaaggatcctcagaaactggagcagcgtttccatagaaaga
atcgtccttgaggacacaaggagtgttgaggtgacggtgaaactgggagacctttcacct
gatgatgtactggttgaacttttgattggaagaggagaaagcatggaagatctggagatc
tggaaggtgatacagataagaaagcacagaagggaaggggatctgttcatctacagttat
gtcaacggtgccctcggtcatcttggctctccgggatggttctacgcggtgagggtgcta
ccttatcatccgaaacttcccaccagattcttgccggagatacctgtggtgtggaaaaag
gttctcgggtga

DBGET integrated database retrieval system