KEGG   Terriglobus roseus: Terro_0004Help
Entry
Terro_0004        CDS       T02140                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
trs  Terriglobus roseus
Pathway
trs00040  Pentose and glucuronate interconversions
trs00051  Fructose and mannose metabolism
trs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Terro_0004
   00051 Fructose and mannose metabolism
    Terro_0004
Enzymes [BR:trs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Terro_0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Shikimate_DH UDPG_MGDP_dh_N Pyr_redox NAD_binding_8 DAO AlaDh_PNT_C ThiF 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFL86356
UniProt: I3ZAT8
LinkDB All DBs
Position
4261..5292
Genome map
AA seq 343 aa AA seqDB search
MKALMLEEYSHLEVVDVPEPACGPDEVLIRVAACGICGSDVHGYDGSSGRRIPPIIMGHE
AAGVIAKIGADVRDWKLGDRVTFDSTVYCGACDFCTQGLVNLCDSRQVVGVSPGDYRRHG
AFAELVSVPARILYRLPDVFDFKEAAMLEAVSIALHGVSVAQLKGGESALVIGAGMIGLL
TAQAARAAGCSSVMIADVDAARLEMAKEVGIPDTLHLSGNDLVAEVLKRTNGRGVDVVLE
AVGRAETVVASIECVKRGGTVTLIGNIQPEVPLPLQRVVTREIRLQGSCGSAGEYPEAIR
LMASGAITVKPLISAVSSLEEAAGYFARLHGREDGLLKVVVTP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttgatgctcgaagagtattcgcacctggaagtcgtcgatgtacctgagccc
gcgtgcgggcccgatgaggtcttgatccgcgtggctgcgtgcggtatctgcggcagcgac
gtccacggctacgacggcagcagcggccggcgcatcccgcccatcatcatggggcatgag
gccgcaggagtcatcgcaaagatcggcgcggacgtaagggactggaagctcggcgatcgc
gtcaccttcgactccaccgtctactgcggcgcatgcgatttctgcacgcagggcctggtc
aatctctgcgattcgcgtcaggtcgtcggcgtctcccccggcgactatcgccgccacggc
gcgtttgctgaactggtcagcgtgcccgcgcgcattctctatcgcctgccggatgtcttc
gacttcaaagaagcggcaatgcttgaagccgtctccatcgcactgcatggtgtcagcgtc
gcgcaactaaaaggcggcgaatccgcactggtgatcggtgccggcatgatcggcctgctg
accgcgcaggcagcgcgcgcagccggttgcagctccgtgatgatcgcggacgtcgatgcg
gctcgccttgagatggcgaaagaagtcggcatcccggacaccctgcacctcagcggcaac
gacctggtcgccgaagtgctgaagcgcaccaacggtcgcggcgttgatgttgttctcgaa
gctgtaggacgcgccgaaactgtcgtcgcttctatcgagtgcgtcaagcgcggcggcacc
gtcacgctgatcggtaacattcagccagaggttccgttgcccttgcagcgtgtggtcacg
cgtgagattcggctgcagggctcgtgcggttccgccggtgagtatccggaagcaattcgc
ttgatggccagcggtgccatcacggtcaagccgctgatctctgcggtctcgtctctggaa
gaagcggcaggctacttcgcgcggttgcacggccgtgaagacggcctgttaaaagttgta
gtaactccgtaa

DBGET integrated database retrieval system