KEGG   Terriglobus roseus: Terro_0073Help
Entry
Terro_0073        CDS       T02140                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
trs  Terriglobus roseus
Pathway
trs00564  Glycerophospholipid metabolism
trs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Terro_0073
Enzymes [BR:trs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Terro_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA FAD_binding_3 NAD_binding_8 HI0933_like Pyr_redox Pyr_redox_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFL86424
UniProt: I3ZB06
LinkDB All DBs
Position
complement(76701..78269)
Genome map
AA seq 522 aa AA seqDB search
MNREAMMQAVRAQGSEPWDIVIIGGGATGAGVAVDAATRGYKTLLVEREDFGKGTSSRST
KLVHGGVRYLEQGNISLVMEALKERGLLRANAPHLVHDMPFVVPNYEWWEAPFYGIGMKV
YDLLATKYSFGKSRILSREETLQRLPTIAQEGLRGGVVYHDGQFDDTRLLTHLVMTAADH
GATVLNYCSAVELLRGDDGFLNGIVVEDRESGERIRVQAKCVVNATGIFTDETRRMAEPA
ATTMVSPSQGIHLVLEKSFLRAETAIMVPRTSDGRVLFAIPWHGHTVVGTTDTPIDAPSY
EPLPLEEEIAFVLDTAGEYLSRKPTREDILSIYVGIRPLVKAAGGDGNKTSSLSRDHTIH
IDGSGLLTIVGGKWTTYRHMAEDTVNHAATLGHLPDAPCTTATLRVHGWSDAQDLGELLV
YGADAAGVRALADASPELAEKLHPALPYLAAEIVWAAREEMSRTLDDALSRRTRALLLNA
RAAIAIAPKVAELMAKELGRDEAWKREQVDAFKTLAQQYLPQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgaagccatgatgcaagcagtgcgcgcgcagggtagtgagccgtgggacatc
gtcatcattggcggtggcgcaacgggtgcgggtgttgcggtggatgctgcgacacgcggc
tacaagacgctgctggtggagcgcgaggactttggcaagggtaccagcagccgcagcacc
aagctggtgcatggtggtgtgcgttacctggagcagggcaacatctccctggtgatggag
gcgttgaaggaacgcggtctgctgcgggccaacgcgccgcacctggtgcatgacatgcca
ttcgtggtgccgaactacgagtggtgggaagctccgttttacggcatcggcatgaaggtc
tatgacctgctggcgacgaagtattcctttggtaagtcgcgaattctgtcgcgcgaagag
acgctgcaacgcctgcccacgattgcgcaagagggtctgcgcggcggtgtggtgtatcac
gatggccagttcgacgatacgcgcctgctgacacacctggtgatgacggcggcggaccat
ggtgcgacggtgctgaactactgctcggcggtggaactgctgcgtggtgatgacggcttt
ctgaatggcattgtcgtcgaagaccgcgagagcggcgagcgcatccgtgtgcaggcaaag
tgtgtcgtgaacgccaccggcatctttaccgacgagacgcgccgcatggccgagcctgcg
gcgacgacgatggtgtcgccttcgcagggaattcacctggtgctcgagaagagctttctt
cgcgcagagacggcgatcatggtgccgcggaccagcgatggtcgcgtgctcttcgcgatc
ccgtggcatgggcacacggttgtcggcacgaccgatacgccgattgatgcaccgagctat
gagccgctgccgctggaagaggagattgcctttgtgctggatactgcgggcgagtatcta
agccgcaaacccacgcgtgaggacatcctgtccatctacgtcggcattcgtccgctggtg
aaggcggctggtggcgacggcaacaagacgagttctctgtcgcgcgatcatacgatccac
atcgacggcagcggcctgctgacgattgttggtggtaagtggacgacctatcgccacatg
gccgaagacacggtgaatcacgccgcgacgctgggccatctgcccgatgcgccatgcaca
acggcaacgctgcgcgtgcatggatggagcgacgcgcaggaccttggcgagctgctggtc
tatggtgccgatgccgccggtgttcgcgcgctcgcggatgcttcgccggagcttgccgag
aagctgcatccggctctgccgtaccttgcagcggagattgtgtgggccgcgcgcgaggag
atgtcgcgcacgctggatgatgctctttcccggcgaacacgtgcgttactgctgaatgca
cgcgcggccattgccattgcgccgaaggtggcggaactgatggcgaaggagcttggtcgt
gatgaagcctggaagcgggaacaggtggatgcatttaagacgttggcacagcagtacctg
ccgcagtag

DBGET integrated database retrieval system