KEGG   Takifugu rubripes (torafugu): 100294698
Entry
100294698         CDS       T02386                                 

Gene name
scf
Definition
(RefSeq) stem cell factor precursor
  KO
K05461  KIT ligand
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100294698 (scf)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100294698 (scf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tru04052]
    100294698 (scf)
Cytokines and growth factors [BR:tru04052]
 Growth factors
  Growth factors (RTK binding)
   100294698 (scf)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 100294698
NCBI-ProteinID: NP_001153658
Ensembl: ENSTRUG00000019861
UniProt: C1PGH3
LinkDB
Position
9
AA seq 270 aa
MKKSKIRIRICVHLLLFITLGVHSTKFDVNPVTDDISRLSVLKNNIPKDYKIPLDYIPKA
TGGICWVKLNVFCLENSLHNLSHTFGNISSNRKDLSIFIKMFQELRFNLEPVEPIMYEFD
CHYRKERWQTAKYFDLVKEFLIAAQNGDNSDDCEPPPCPTSPRPVTTEEYLTESSTVISS
NGPECTTGCTTYHNPSPLSEVVERSLLSLLFIPLLALVFLLVWKVRSRRNREDMEQDSGE
RGCFTGAEGTASPLDADISEKNNLSTIETV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaattcggatacgcatttgtgtccacttactgctgttcatcacgctt
ggggtacattcaactaaatttgacgtcaacccagtgacagatgacatctccagactctct
gttttgaaaaacaatattccgaaagattacaaaattcctctggattacattccaaaagca
acgggtgggatctgttgggtaaaattgaacgtgttctgcttggagaacagtttacacaat
ttatcgcatacgtttgggaacatatcatccaacagaaaagatttaagcatattcatcaaa
atgttccaagagctgcgcttcaatttggagcctgtggaacccatcatgtatgaatttgac
tgccactacaggaaagagaggtggcagacagcaaagtactttgacttggtcaaagaattc
ctcatagcggcacaaaatggagacaattccgacgactgcgaacctcccccctgtcccacc
tcgccgcgaccagtaacgacagaagaatatttaacagaatcgtccacagtgattagcagt
aatggcccagagtgtacaacaggctgtacaacataccacaatccaagccccctgagtgag
gtggtggagcgaagccttctttctttactcttcattccactcttagccctggttttcctg
cttgtgtggaaggtcagatcacgaagaaaccgggaagatatggagcaggattccggagaa
cgtggatgctttacaggagcagaagggactgcgtccccactggatgcagacatatcagag
aaaaacaacctgagcaccattgaaacagtgtaa

DBGET integrated database retrieval system