KEGG   Takifugu rubripes (torafugu): 101061104
Entry
101061104         CDS       T02386                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A
  KO
K04291  lysophosphatidic acid receptor 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04080  Neuroactive ligand-receptor interaction
tru04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101061104
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101061104
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tru04030]
    101061104
G protein-coupled receptors [BR:tru04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    101061104
SSDB
Motif
Pfam: 7tm_1 Flavi_NS2A 7tm_4
Other DBs
NCBI-GeneID: 101061104
NCBI-ProteinID: XP_011602362
Ensembl: ENSTRUG00000024303
LinkDB
Position
5
AA seq 380 aa
MYLRFQVESVTMEDNLTAGVESDSWSTCDYTRNVSFFYNLVGKEIRTVWTTRDILVIGLG
LTVCFIVVLANLMVMVAIFMNQRFHFPIYFLLGNMAAADLFAGIAYVNLMLNTGPWTSTL
TKQQWYIRGALIDISLTASVANLLAVAVERHQTIITMQLHSTMSRRRVVLLMLGIWAVSI
IMGLVPSTFWNCECDLHDCSTVAPIYSRRFLILWAGLNLLTFLIMVAMYTRIFVYVRHQS
RYASQHTSDKRNSRTVINLMKTISMVLGAFVVCWTPGLVTLLLDGLLGKDSHANMYEKFC
LVMAECNSLVNPIIYTLRDEEMRRTFRWILCCLCGRTKGREVSPVGFAPVTPQETVDYVL
KSEEDAAKSDNENSWSIGGL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtatctgcggtttcaggtggaatctgtcacaatggaagataatctaactgcgggagta
gagagcgactcgtggagcacctgcgactacacccgcaatgtatctttcttctacaatttg
gtgggtaaagagatccggacagtgtggacgacgcgggacattctggtgattggactggga
ctgacagtatgtttcattgtagtcctggccaacctgatggtgatggtggccatcttcatg
aaccagcgcttccacttccccatctactttctcttgggcaacatggctgcagcagacctg
tttgcaggaattgcatatgtcaacttgatgttgaacacaggcccctggacaagcacgctc
acaaagcagcagtggtacatccgtggagccttgattgacatcagcctgacagcctcggtg
gccaacctgctggccgttgctgtggagcgccaccagaccatcatcaccatgcagctgcac
agcaccatgagcaggcggcgcgtcgtgctgctgatgctgggcatttgggcagtgagcatc
atcatgggcttggtgccctcaaccttctggaactgcgagtgtgatctgcatgactgttcc
accgtggcgcccatttacagcagacgcttcctcattctctgggcaggtctcaacttgctg
actttccttatcatggtggccatgtacacccgcatctttgtctatgtgagacaccaaagc
aggtatgcgtctcagcacacatcagacaaaaggaacagccggactgtgatcaacctgatg
aaaacaatctccatggttttaggagctttcgtggtctgctggactccgggcctggtgacg
ctcttactggatgggctgctgggcaaagacagccacgccaacatgtatgagaaattctgc
ctggtgatggcagagtgcaactcactggtcaaccccatcatctacactctgcgggacgag
gagatgcgcaggacgttcagatggatcctgtgctgcttgtgcggaaggaccaaagggagg
gaagtctcgccggtcggatttgcaccagtaacaccacaggaaactgttgactatgtcctg
aagtcagaagaggacgcagctaaatccgataatgaaaacagctggagtatcggggggctg
tga

DBGET integrated database retrieval system