KEGG   Takifugu rubripes (torafugu): 101061278
Entry
101061278         CDS       T02386                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04068  FoxO signaling pathway
tru04110  Cell cycle
tru04115  p53 signaling pathway
tru04218  Cellular senescence
tru04310  Wnt signaling pathway
tru04340  Hedgehog signaling pathway
tru04371  Apelin signaling pathway
tru04510  Focal adhesion
tru04530  Tight junction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101061278 (ccnd1)
   04340 Hedgehog signaling pathway
    101061278 (ccnd1)
   04371 Apelin signaling pathway
    101061278 (ccnd1)
   04068 FoxO signaling pathway
    101061278 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101061278 (ccnd1)
   04115 p53 signaling pathway
    101061278 (ccnd1)
   04218 Cellular senescence
    101061278 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101061278 (ccnd1)
   04530 Tight junction
    101061278 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101061278
NCBI-ProteinID: XP_029702239
LinkDB
Position
13
AA seq 292 aa
MGEKLLCCEVDSIRRAYQDANLLNDRVLLTMLKAEEHYLPSPNYFKCVQKELVPKMRKIA
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATSKTRLQLLGATCMFLASKMKETVPLS
VEKLCIYTDNSVHPGELLQMELLVLSKLKWDLASVMPHDFIEHFLSKLRIFPSTKHILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSLDASFSSQNLTNLLSQVIGSD
PDCLRACQEQIESLLESSLQQVQHHNNTKEPKCVASDADLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggggagaaactgctgtgctgcgaagtggactccatcaggagagcctaccaggacgcc
aacctgctcaacgaccgagtcctcctgactatgttgaaggcagaggaacattatttaccc
tctccaaactactttaagtgcgtgcagaaagaacttgtgcccaaaatgaggaaaattgct
gccacttggatgttggaggtctgtgaggaacagaaatgtgaagaggaggttttccctctg
gctatgaactatttggacagatttttatcagtggaagccaccagtaaaacaagactacaa
cttctgggggcaacgtgcatgtttctcgcatcaaagatgaaggagacggtgccattatca
gtggaaaaactctgcatctatacagacaactctgtccatcctggagagctgctgcaaatg
gagctgctggttctgagcaaactgaagtgggacttggcttcagtcatgccgcatgatttc
attgagcacttcttgtccaagctgaggatctttccatccaccaagcacatcctgagaaaa
catgctcagacatttgttgctctttgtgccacagatgtcaactttattgcaagtcctcca
tcaatggttgcagcaggcagcgtagtagcagctgtacagggtctctatctgaagagcctc
gatgcctcattttcctctcagaacctcacaaacctgctatcacaggtcattggcagtgac
ccggactgcttgcgggcatgtcaagagcagatagagtctctactggagtccagcctgcag
caggttcagcaccacaacaacaccaaagaaccaaaatgtgtggccagtgatgcagacctg
tcctgcaccccaacggatgtgagagatatcaacatctga

DBGET integrated database retrieval system