KEGG   Takifugu rubripes (torafugu): 101061387Help
Entry
101061387         CDS       T02386                                 

Gene name
ganc
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00052  Galactose metabolism
tru00500  Starch and sucrose metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101061387 (ganc)
   00500 Starch and sucrose metabolism
    101061387 (ganc)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101061387 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101061387
NCBI-ProteinID: XP_011618132
LinkDB All DBs
Position
Un
AA seq 865 aa AA seqDB search
MQHRALLDTLVLTESGARLELLEPDTQTLLLLSLSASNNGSVGIVIDELHPIKARYRVPD
VIVGAAACEQLSVQQQSDDSVTLSWSSGPHALRVWRFPFRLEILWRGDVMVTFNSRGKLW
LEPLQHPHRVGPQVAADQTGPPWTETFQGFVDVQANGPSSVGADFCFHGFSHVYGVPEHA
DDLRLRDTRHGEPYRLYNLDTFAYDLHSRLGLYGSVPLLLAHKPGRTLGVLWLNASETFL
DVGYSSSEHQDEAAPPVKRRSVEPWTDVHWVSEGGVIDCRVLLGPGPHQLFSQYAHLTGY
QALPPLFALGYHQCRYSYEDEADVKAVDAGFDEHDIPYDVIWLDIDHTDQKRYFTWDPAL
FPEPVLLQRHLEAKKRKLVVISDPHIKVDPEWWLYRQARDQGHFIKTRDGRIFQGSCWSG
ECSYLDFSRPHTRAWYSRCFGLDKYEGSTPSLFVWIDMNEPSVFDGPEQTMPKDAVHYGG
WEHRELHNLYGFYQHMATAEGLITRSGGVARPFVLSRSFFAGSQRFGAIWTGDSCASWDY
LKITVPMLLSLSMAGISFCGADVGGFMKDPEPELLVRWYQAAALQPFFRGHSSKCAKRRE
PWLFGEEVTGAIRTAIRQRYCLLPYWYTLFHHSHTSGVPPLRPLWVEFQKEQSTFAVDNQ
YMIGGALLACPVTDPGVQEVKVLLPGPGEVWYDVHSTKTYRGGTTVSFPVTLDTVPLFQR
GGSVVCRWVGRGSCTADFQQLPLSITVALSAQGAADGEVYMDDGHSFSYRDRKAFCLRSF
RMQSGRLTCCSGSDEGTFDCDTVIQSVTVLGMERSPSAVAVQVSGEDLTCGRAATVDFQY
TETCCMVAVTGLKLRATLDWEIQML
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaccgggcccttttggacaccttggtgctcacagagagcggggctcggttggaa
ctgctggaacctgacacacagacgctgctgcttctttctctgtcggcttccaacaatggc
tccgtggggatcgtgatagatgagctccatcccatcaaagcccgctacagagttccagat
gtgatcgtcggggcagcggcgtgtgaacaactgagtgtgcagcaacaatcggacgactcc
gtcaccctttcttggtcctcgggaccgcacgcgcttcgtgtgtggcgtttcccgtttcgc
ctggagatcctgtggcgaggtgacgtcatggttacgttcaactccagaggaaaactgtgg
ttggagcctctgcagcatccacacagggtgggtccccaggtggcagcagaccagacgggt
ccaccatggacagagaccttccaggggtttgtggacgtccaagctaatggtcccagcagc
gtcggggcagacttctgctttcacggcttcagtcacgtgtacggcgtcccggagcacgcc
gatgacctgcggctcagagacaccagacacggggagccctatcgtctttataacctggac
accttcgcctatgacctgcacagccgcctgggcctgtacgggtccgtgccgctgctgctg
gcccacaagcccggcagaactctgggcgtcctctggctgaacgcctcggaaaccttcctg
gatgttggttacagctcatctgagcatcaggatgaagctgcacctccagtgaagaggagg
agcgtggagccctggactgacgtccactgggtgtcggaaggtggcgtcatcgactgcagg
gttctgctggggcccggcccgcaccagctcttctcccagtacgctcatcttacagggtac
caggccctgccccccctgttcgcgctgggctaccatcagtgccgctacagctacgaggac
gaagccgacgtgaaagccgtggatgctggatttgacgagcacgacatcccgtacgacgtc
atctggctcgacattgaccacacggaccagaagaggtatttcacgtgggaccctgcgctt
ttcccggagccggtgctgctgcagcgccacctagaggccaagaagaggaagctggtggtt
attagtgaccctcacatcaaggtggacccggagtggtggctgtaccggcaggcccgagac
cagggccatttcatcaagacccgggacgggcggatctttcagggctcctgctggtctggt
gagtgctcttacctggacttcagccgtccacacacccgtgcgtggtactccaggtgcttt
ggccttgataagtacgagggatcgacaccatctttattcgtgtggatcgacatgaacgaa
ccgtctgtctttgacgggcccgagcagaccatgcccaaagatgcagtgcattatgggggc
tgggaacaccgggaattacacaacctgtacggtttctaccagcacatggccacggcggag
ggtctgataacgcgctcaggaggcgtggccagaccgttcgtgctctcccgctccttcttt
gctggatcacagagatttggagcgatatggacgggcgacagctgtgccagctgggattat
ctgaagatcaccgttccaatgcttttgtctctaagcatggcgggaatatcattttgtgga
gccgacgtcggcggcttcatgaaggatccggaaccagagcttctggtgcgctggtaccag
gcagccgccctgcagcctttcttccgcggtcactcctcaaagtgtgccaagcgtcgggag
ccgtggctgtttggggaagaggtcaccggtgcgatccgcaccgccattcggcagaggtac
tgtttgctgccatactggtacaccctgttccaccactctcacacatcaggtgtgcctcca
ctcaggcctctgtgggtggagttccagaaagaacagagcacctttgctgtggacaaccag
tatatgataggtggagccctgctggcatgtcctgtcactgatcccggggttcaagaagtt
aaagtcctacttcctggaccaggagaggtctggtatgatgtccactccacaaagacgtat
agaggaggcacaactgtgagttttccagtcacgctggacacagttcccctgttccagcgc
ggcggctcagtggtctgcaggtgggtgggacgtggctcctgtaccgctgacttccagcag
cttcctctctccatcactgtggccctcagcgctcagggtgcagccgatggcgaggtgtac
atggatgatggtcactccttcagttaccgtgacagaaaggccttctgcctgcgcagcttc
agaatgcagtcgggccgcctcacctgctgttctggcagtgatgagggaacctttgattgt
gacactgtgatacagtcggtcaccgtcctggggatggagcgcagcccatccgctgtggcc
gtgcaggtgtcgggtgaggatcttacgtgtggtagagctgcaactgtggactttcagtac
acggagacgtgctgcatggtggccgtgaccggcctgaagctcagagccacgctggactgg
gagatacagatgctgtag

DBGET integrated database retrieval system