KEGG   Takifugu rubripes (torafugu): 101061688
Entry
101061688         CDS       T02386                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04060  Cytokine-cytokine receptor interaction
tru04068  FoxO signaling pathway
tru04144  Endocytosis
tru04218  Cellular senescence
tru04350  TGF-beta signaling pathway
tru04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101061688
   04350 TGF-beta signaling pathway
    101061688
   04068 FoxO signaling pathway
    101061688
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101061688
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101061688
  09143 Cell growth and death
   04218 Cellular senescence
    101061688
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101061688
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101061688
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101061688
Protein kinases [BR:tru01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101061688
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 101061688
NCBI-ProteinID: XP_029706805
Ensembl: ENSTRUG00000000430
LinkDB
Position
1
AA seq 618 aa
MMAPGWALWAGMAAVLAAAPPPGAWSFTHLSGNLCKWCEVSSPTCGDNVCFSNCTLSSFC
TVTEEICIAIWRKTNESMTVHTMCHDPTLPLEGVNPALLLNFTSRECHMTSQPTEGATMM
VCGCRGEHECNDRLIFDQGANGFAKLQSKDVLPVVGVSLVPPLLVAVAATVAFYIYRTRH
LDKPDSPARPDWTPKQTTDLYLASDLPCGGLSGGEGGCAGSLTGGVDREASQAKNSHSDV
INNMTDCPGQGKELLPIKLEVLVGKGRFAEVWSGRLLRGGKGGSNSHETVAVKVFPAVEY
ASWRNECSIFSDPNMAHDNIVRFHAAEDRGPPGHALTQHWLILAYHSLGNLQDFLTANIL
GWEELVAMAGSIAKGLAHLHSDTTQEGLPKVPVAHRDLKSSNIVMKSRTECALCDFGLAL
RLDVSLTVDDYANSGQVGTARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMASRCQ
ATGEVKSYEPAFGSQVCEQPCVDSMRDLVLRDRGRPDIPALWSQHKGLSIFCSTIIECWD
HDPEARLTAHCVVERFKALQNEEEELRHHGDAHREKDLETPEKDQMTTSSSEALQAQTEV
SHDALGFCSVSWATCPTV
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgatggctccgggctgggcgctctgggccgggatggctgcggttctggctgcggcgccc
cctcctggcgcctggtccttcacccacctgagtggtaacctgtgtaagtggtgcgaggtg
tccagtcccacctgtggagacaacgtctgcttcagcaactgcacgctgtcgtccttctgc
accgtcaccgaggagatctgcatcgccatatggaggaagaccaacgaatcaatgaccgtc
cacacgatgtgtcatgacccaactctgccgctagagggcgtcaaccccgctcttctgctc
aacttcacctcgagggagtgtcacatgacgtcacagcccacggagggcgccaccatgatg
gtctgtggctgcaggggtgaacatgagtgcaacgacaggctcatctttgaccagggggcc
aatggatttgctaagctacaaagcaaagacgtgctcccggtggtgggggtcagtttggtg
cccccccttctcgttgctgttgctgccacagttgccttctacatctaccgcacacgtcac
ctggacaaaccagattcacctgcacggcctgactggactcctaaacagaccacagatctg
tatctggcctctgaccttccctgtgggggtctgtctggaggagagggggggtgtgcagga
agcctgacaggtggtgttgacagggaagcttcccaagccaagaactctcatagtgatgtc
atcaacaacatgaccgattgtcccggtcaggggaaggagttgctgcccatcaagttggag
gtcctagtgggtaaagggcgctttgcagaggtgtggtccggacgcctcctgcgggggggg
aagggagggagtaactcgcatgagacggtggcggtgaaggtgttcccggccgttgagtac
gcgtcctggaggaacgagtgctccatcttctccgacccaaacatggcgcatgacaacatt
gtccgtttccatgcagccgaggatcgagggccgcctggccacgccctcacacagcactgg
ctgatcctggcctatcacagccttgggaatctgcaggacttcctcacagccaacatttta
ggctgggaggagcttgttgccatggcaggaagcatcgcaaagggtttggctcatctccat
agtgacacaacgcaggagggcctgccaaaggtgccagttgcccaccgggacctgaagagc
agcaacattgtgatgaagagcaggacggagtgcgccctctgtgactttggtctggcgctg
cggttggacgtgtccctcaccgtggacgactatgcaaacagcggacaggtgggaactgct
cgctacatggctcctgaggtgctggagtccagggtgaacctggaagacctggaagccttc
aagcagatggatgtttactccatggctctggtgttatgggagatggcatcacgttgccaa
gccaccggagaggtgaagagctacgagccggcctttggttcccaggtgtgtgagcagccc
tgtgtggacagtatgagggacctggtgctgcgggaccgtggacgaccagacatccctgcg
ctgtggagccaacacaaggggctgagcatcttctgctccaccatcatcgagtgctgggat
cacgatccagaggcccggctgacagctcactgtgtggtggaacgtttcaaagccctgcag
aacgaggaagaggagctgagacaccacggtgatgctcaccgagaaaaggaccttgagaca
ccagagaaggaccagatgaccacctcgtcctcggaggctcttcaggctcagacggaggta
tcccatgatgcactgggcttctgtagtgtcagttgggccacttgtcccaccgtctga

DBGET integrated database retrieval system