KEGG   Takifugu rubripes (torafugu): 101061896Help
Entry
101061896         CDS       T02386                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101061896 (tmprss9)
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101061896 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Ldl_recept_a SEA DUF1986
Motif
Other DBs
NCBI-GeneID: 101061896
NCBI-ProteinID: XP_011613170
LinkDB All DBs
Position
20
AA seq 799 aa AA seqDB search
MEVKQDGEGDGQRSKTSSAPAYRTCNTAALVASFFLILIFGVFVGLFMAYLVQEQHDFME
TVQLKGLKYDSALQDINSGYYIVLSSIIKTKIKNVFSASTISRHYVDSSIVAFGDANGDV
LATFRVVFRVSRLQQYSDGFVQELLRAGLGAELYGKPLEVPGYGGIDSIVLLGASGKSFY
NIGANAMASCPDSTFTCDSGECVTKVNPECDFIADCADGSDEARCDCGTRPTMGNRVVGG
EDAREGELPWQVSLRLHGHHTCGASIINERWLVSAAHCFTSEGDPTGWTAMVGATQVDGK
ELQSKVINIKSLVVSPFYDSQTTDNDITMVELEKPLTFGPYIQPVCLPSVSHVFAPGKRC
IVSGWGALHQFNPKLPTTLQKAVVKIIDSKVCNKSSVYQGSITDNMMCAGFLQGKVDSCQ
GDSGGPLVCQGAPGRFFLAGVVSWGVGCAQINKPGVYSRVTRLLNWILRHTNPSLAHTDA
QQVPDVPLGLEGATDLPPVPGPADIDEDASLVLSDLPASNCSGNFQCSSASCIAKVNPEC
DGVPDCPNQADEENCNCGTRPALGSNKIVGGVTARRGEWPWIGSLQYQKLHRCGATLVHS
KWLLTAAHCFKRDPSPDNWAVSLGSVLRSGGGALVIPIQRIVIHPEFNSTNMDQDVALLE
LAVPAPVSYTVQPVCLPSPVHSFPETAECYITGWGSTREGGSLTNLLQKAAVNLIDQADC
QRSYGDVLTPHMMCAGYMEGGKDTCLGDSGGPLVCQQLSGQWFIAGVTSWGHGCGRTGFP
GVYTRVTSIRTWMSTYLPF
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaaacaggatggcgaaggagatggccagaggtccaaaacctcctcggctccc
gcctatcgtacctgcaacacggccgctcttgtggcttccttcttcttgatcctcatcttc
ggggtgtttgtgggtctgtttatggcctacctggtgcaggaacagcatgatttcatggag
acggtgcagctgaaggggttaaagtacgattcagctctacaggatataaactctgggtac
tacatcgtgctgtcgtccatcataaagaccaagattaaaaatgtcttcagcgcctcgacg
atatcgcgtcactacgtcgacagcagtattgtcgccttcggtgacgccaacggcgacgtg
ctggccaccttccgggtggtcttcagggtctccaggctgcagcagtattccgacggcttc
gtccaggaactgctgagggcggggctcggagcggagctgtacgggaaaccgctggaggtg
ccgggatacggagggatcgactccatcgtcctgctgggcgccagcgggaagtcgttctac
aacatcggggccaacgcgatggcctcatgtccagacagcaccttcacctgtgacagtggg
gagtgcgtcaccaaagtgaacccagagtgcgacttcatcgccgactgcgccgacgggtct
gacgaagcccgctgcgactgtgggacgcgtcccaccatggggaaccgagtggtgggtggg
gaggatgctcgggagggggagctgccttggcaggtcagtctgaggctgcacggacaccac
acctgcggggcctccatcatcaacgagcgctggctcgtcagcgcagcgcactgtttcacg
agcgaaggagaccccacaggctggacggcgatggtcggcgccacacaagttgatgggaag
gagcttcagtccaaggtgattaacatcaagtccctggttgtgtcgccattctacgactca
cagaccacggacaacgacatcaccatggtggagctggagaagcctctcaccttcggcccg
tacatccagcccgtctgcctgccctctgtgtcccacgtgtttgcccccgggaagaggtgt
atagtgtcggggtggggcgcgctgcaccagtttaaccccaagctgcccaccacgctgcag
aaggcggtggtgaagatcatcgactccaaggtgtgcaacaagtcatctgtgtaccaaggc
agcatcaccgacaacatgatgtgcgccggcttcctgcagggaaaggtggactcgtgtcag
ggagactctggaggacctttggtgtgtcagggggctccgggcaggttctttctggctgga
gtggtgagttggggtgtgggctgtgcccagatcaacaagcctggtgtttattcccgtgtt
accagactcctcaactggatactaagacacaccaatcccagcttggcccatacggatgct
cagcaagtgcccgacgttccactgggtctggaaggagctacagatctgccacccgttccc
gggcccgcagacattgatgaggatgcctcgctagtgctatctgatcttccggcgtcgaac
tgcagcggaaacttccagtgtagctccgcctcctgcatcgccaaggtcaacccagagtgt
gacggcgtcccggactgccccaaccaggccgacgaggaaaactgcaactgcggcactcgc
cctgcgctgggctccaataagatcgtgggcggggttacggctcgtaggggggagtggcct
tggatcggcagcctacagtaccagaagctccaccgatgtggggctacgctcgttcacagc
aagtggttgctcacagcagcacactgcttcaaaagggatcccagccccgataactgggcg
gtgagcctgggatctgtgctgcgctctggtggtggggctctggtcatccccatccagagg
atcgtcatccacccagagttcaacagcaccaacatggaccaggacgtggccctcctggag
ctggccgtcccggcacccgtgtcctacaccgtccagcccgtgtgcctcccctcgccggtg
cacagcttcccggagacggcagagtgttacatcacaggctggggatccaccagggaggga
ggttctttgaccaacctgctgcagaaagctgccgtgaacctcatcgaccaggccgactgc
cagcgttcctacggagacgtgctgacgcctcacatgatgtgtgctggttacatggaagga
ggcaaagacacctgtttgggagactctgggggtccactggtctgccagcagctctctggc
cagtggtttattgctggggtgaccagctggggacacgggtgcggacgaaccggcttcccg
ggcgtttacacacgcgtgacgtccatcaggacctggatgtctacatacctgcctttctga

DBGET integrated database retrieval system