KEGG   Takifugu rubripes (torafugu): 101062852
Entry
101062852         CDS       T02386                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101062852
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101062852
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tru03310]
    101062852
Transcription factors [BR:tru03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101062852
Nuclear receptors [BR:tru03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101062852
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 101062852
NCBI-ProteinID: XP_003970455
Ensembl: ENSTRUG00000007443
LinkDB
Position
14
AA seq 775 aa
MDKDGVKKVTYRRDDPLRKLVYTESPEEGGLLKVAPHGAMSITSATPSQLLQPGQVSNGL
GNSSFPEELAPGTANVSHLSENPEIKGPTKDQKLQEQQLCFLHTSTSLGGQILRESLPQL
EANTIDGTQSSMDSLIGGSDPNFFPMKTDDFSMDNGDQDPIEIDPSFEPIRKDGDVHQKL
FSDNTLDLLQDFELIGSPSDFYVGDDALLYSLAEDSLLGDASSEKDLKSVVVEGVAGSGA
LSALNGSNILSPDQSSISTTASLMPSPALSVVVKKEKDADFIQLHTPGVIKEEKTSPGQN
YCQMSSASSPEMLSSIISVCGVSTSGGQSYHFGVSPSSGEAQQQRNQNQKPVSNQYLPVT
TLSGAWSREGESAAVHKVAEAFSRSPSYPVCFTSSTNRQEGVTATSTVQGKSGSKICVVC
SDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMA
GMNLEARKTKKLNRLKGVQQSNPPKPTTPCLPVEPCSLVPKCMPQLVPTMLSLLKAIEPE
TIYAGYDSTVPDTSTRLMTTLNRLGGQQVISAVKWAKALPGFRNLHLDDQMTLLQYSWLF
LMSFSLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMADQCEQMLKISSEFVRLQVSHDE
YLCMKVLLLLSTVPKDGLKSQAVFDDIRMSYIKELGKAIVKREQNSSQNWQRFYQLTKLL
DSMHEMVGGLLRFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSIKPLLFHQR
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggacaaagatggagtgaagaaagtaacatacaggagagatgaccctttaagaaaactg
gtctacactgaaagccctgaggagggaggtctgctgaaggtggctccccatggtgccatg
tccatcacatctgccacaccgagccagttgctgcagccaggacaagtgtccaacggcctt
gggaacagttccttcccagaagagctcgcgcctgggactgcaaacgtatcccacttatcg
gaaaacccggagatcaagggtccgaccaaagatcagaaacttcaggagcagcagttgtgt
ttcctacacacgtccacgtccctcgggggtcaaattttaagggaaagcctcccccagttg
gaggccaataccatagatggtacacagtcctccatggattcgcttattggggggtcagat
cctaacttcttcccaatgaagacagatgatttctccatggataacggagaccaggacccc
attgagattgatccttcctttgagcccattagaaaagatggagatgtgcatcagaaactc
ttcagtgacaataccttggacctgctccaagactttgagctcattggatccccctctgat
ttttatgtgggagatgatgctttgctttactctctggcagaagattccctgcttggggac
gctagctccgagaaggacctcaagtctgttgttgtagagggtgtcgctggcagtggagcc
ctctctgccttgaatggcagcaacatattaagtccagaccagtcaagcatatctacaaca
gcctccttaatgccttcccccgctctgtctgtagtagtgaagaaggaaaaggatgccgac
tttatccagctgcacaccccaggtgtgatcaaagaggagaaaacgtcccccggccagaat
tactgccagatgagcagcgcatcctccccagaaatgctcagctccatcatctctgtctgt
ggggtcagcacctccggaggacagagttaccactttggagtcagccccagcagcggcgaa
gctcagcagcagcggaatcagaaccagaagccagtgtccaaccagtatctacctgtcacc
accctgagcggggcctggagccgagaaggggagagcgctgcagtccacaaggttgccgag
gctttctccaggtccccttcataccccgtctgctttaccagttccaccaacagacaggaa
ggtgtcactgcgacgtcaactgtgcagggaaagagtgggagtaaaatctgcgtggtttgc
tctgatgaggcgtcaggttgtcactacggagttctcacctgcgggagctgcaaggtcttc
ttcaaaagagcagtcgaaggacagcataattacttgtgtgctgggagaaatgactgcata
atagacaagatcaggagaaagaactgcccagcatgccgcttccgcaagtgtctgatggct
ggcatgaacctggaagcacgtaaaactaagaagctgaaccggctgaagggcgtccagcag
agcaacccgcccaagcccacgacgccttgtcttcctgtggagccttgctcactcgtaccc
aagtgcatgccccagctcgttcccaccatgttgtccctgctgaaagccatcgagccggag
accatctacgctggctatgacagcaccgtgccagacacatccacccgcctcatgaccacg
ctcaacagactgggaggtcagcaggtcatttctgctgtcaagtgggccaaagctctccca
gggttcaggaacctgcacctggatgatcagatgactctgttgcagtactcctggctcttc
ctcatgtctttcagtctgggctggaggtcttaccagcagtgtaacgggaacatgctttgc
tttgcaccagacctggtcataaatgaggagcggatgaagctaccctacatggctgaccag
tgcgagcagatgctgaagatttccagtgagtttgttcgtctgcaggtctcccacgacgag
tacctgtgcatgaaggtcctgttgcttctcagcacagtgccaaaagacggcttaaagagc
caggcggtgtttgacgacatccgcatgtcctacatcaaggagctggggaaagccatcgtg
aagcgcgaacagaactccagccagaactggcagcgtttctatcagctcaccaagctgctg
gattccatgcatgagatggttggagggcttctcaggttctgcttctacacctttgtgaat
aagtccctgagtgtagagtttcctgaaatgttggcagagatcatcagcaaccagttacca
aaattcaaggccgggagcatcaagccgctcctgttccaccagagatga

DBGET integrated database retrieval system