KEGG   Takifugu rubripes (torafugu): 101063003Help
Entry
101063003         CDS       T02386                                 

Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A-like isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00270  Cysteine and methionine metabolism
tru01100  Metabolic pathways
Module
tru_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    101063003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tru03032]
    101063003
   03036 Chromosome and associated proteins [BR:tru03036]
    101063003
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     101063003
DNA replication proteins [BR:tru03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    101063003
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101063003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 101063003
NCBI-ProteinID: XP_011610596
Ensembl: ENSTRUG00000003838
LinkDB All DBs
Position
16
AA seq 841 aa AA seqDB search
MPSNSPAATEPPQTPENDATNDMSEDGADQDSPEEGTPASPRSKRRVGRPGRKRKQLLPE
MATSDPCANAPPTPPEEPEPSPSPRKRRGRRRLEQTERNKDEPDDRNCDSPREGETGRLR
RRPVPRVTFQAGDPYYISRRQREEWLSRWKMEAERRAYREAEISMMDDISEADSHKEEEP
ASPAPPPSQHTDPASPTVAVTPEPVVRGEQATPSEIEYQDGRSFGIGTLVFGKLRGFSWW
PGRIVSWWMSGRSRAADGTRWVMWFGDGKFSVVCVEKLMHLSSFSSVFHQPTYNKQSMYR
KAIFEALQVASVRAGRPVPSCDSSDDADGVEIQTRQMIEWAMTGFLPTGPQALDPPEGEQ
NPYKEVYPEMWAEPEAAYTPPPAKKPRKNAAEKAKIREVIDEGTRERLICEIKKKTRNIE
DICISCGSLNVSLEHPLFVGAMCHGCKNSFLECAYQYDDDGYQSYCTICCGGREVLMCGN
NNCCRCFCVECVDLLVGAGSAAAAIKEDPWNCYMCGPRSTYGLLRRRDDWPSRLQHFFAN
NHEQEFEPAKLYPPVSAEKRKPIRVLSLFDGIATGLLVLKDLGIRVDKYVASEVCEDSIT
VGMVRHHGRIMYVGDVRNVTRKHIEEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLF
FEFYRLLHEARPKLGDERPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRA
RYFWGNLPGMSRPLSPMTNDRLDLQECLEHGRVAKFEKLRTITTRSNSVKQGKDEHFPVF
MDSKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFAC
N
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaacagccccgctgccaccgagccgccccagacgcccgaaaatgacgccacc
aatgacatgagtgaagatggagcggatcaggacagcccagaggaggggaccccagccagc
ccccgcagcaagcgcagagtgggccgtcctggcaggaaacgtaaacagctgcttcctgag
atggcgacttctgacccctgtgccaacgcacccccgacaccgcccgaggaaccagaaccc
tccccgtcccctcgcaaaaggcgtgggcgtcggagactagaacaaacggagaggaacaag
gatgagccagacgacagaaactgcgactcccccagagagggcgagactgggaggctgcgg
aggaggccggttcccagggtgactttccaggccggagatccatattacatcagcaggaga
cagagggaagaatggctgagccgctggaagatggaggcagagcggcgagcctacagagaa
gcagagatcagcatgatggacgacatttccgaggcagactctcacaaagaggaggagcca
gccagcccagccccgcccccttcccaacacacagaccccgcctctcccaccgtggccgtg
accccagagccggtggtcagaggtgaacaggccacccctagtgagatagagtaccaggat
ggccgaagcttcggcatcggaacgttggtgtttgggaagctgcggggtttctcctggtgg
cccggccggatcgtctcctggtggatgagcggtcggagtcgggcagctgacggaactcgc
tgggtgatgtggtttggagacggaaagttctctgtggtctgcgtggagaagctaatgcat
ctgagttctttttcatccgtcttccaccagccaacctacaacaaacagtccatgtacaga
aaggccatctttgaggctctacaggtggccagtgtaagggcgggaaggccagttccttcc
tgtgactcaagcgatgatgctgacggagtagagattcaaaccagacagatgatcgagtgg
gccatgaccggcttcctgccgactggtccacaagctctggaccctccagagggtgaacag
aacccctacaaggaagtgtacccagaaatgtgggccgagcctgaggctgcttacacaccc
ccgcctgccaagaaaccgcgcaagaatgcagctgaaaaggcgaagatcagagaggtcatc
gatgaaggcaccagagagagactcatatgtgagataaagaagaagaccagaaacattgaa
gatatctgcatctcctgtggaagcctgaatgtctctctggagcaccccctcttcgtagga
gccatgtgccacggctgcaaaaactccttcctggagtgcgcctaccagtacgacgatgac
ggctaccagtcctactgcaccatctgctgtggaggcagagaagtgctcatgtgtggcaac
aacaactgctgcaggtgcttctgtgtggagtgtgtggacctgttggtaggagctggatcg
gcagcagcagctatcaaagaggacccctggaactgctacatgtgcggaccacgcagcacc
tacggcttattgaggagaagagacgactggcccagtagactacaacacttctttgccaac
aaccatgagcaggaatttgaaccagccaagctgtatcccccagtttcagcagaaaagaga
aagccaatcagagttctctctctatttgatggtattgccacaggtctgttggtgctgaag
gatttgggcatccgggtggacaaatatgtggcatctgaagtgtgtgaagactccatcact
gtcggcatggttcgacatcacggtcgcatcatgtacgtgggagacgtgcgcaatgtgacg
cgtaaacatatcgaagagtggggaccatttgacctggtgataggaggaagcccctgcaat
gacctctccatagtcaaccctgcaagaaaaggcctgtatgagggaactggacgtttgttt
ttcgagttttaccgtctgctacacgaggctcgaccaaagctgggtgatgagcggccgttc
ttctggctctttgagaatgtggtcgctatgggggtcagcgacaaacgtgatatttcccgt
tttctagagtcgaacccagtcatgattgatgctaaggaggtctctgctgcgcaccgcgcc
cgctacttctgggggaaccttccaggcatgtccagacctctgtctcccatgaccaacgat
aggctggatctgcaggagtgcctggaacacggacgtgtagccaagtttgaaaaattgcgg
acgataacaacacgctccaactctgtaaagcaggggaaagacgagcatttccccgtcttc
atggacagcaaggaggacatcctgtggtgtactgagatggaaagggtctttggttttcct
gtccactacactgatgtgtccaacatgagtcgtctggccaggcagaggctgctgggacgt
tcctggagtgtcccagtcatcaggcacctcttcgctcccctcaaggagtacttcgcctgc
aactag

DBGET integrated database retrieval system