KEGG   Takifugu rubripes (torafugu): 101063011
Entry
101063011         CDS       T02386                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
tru  Takifugu rubripes (torafugu)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 101063011
NCBI-ProteinID: XP_003973380
Ensembl: ENSTRUG00000013510
LinkDB
Position
19
AA seq 363 aa
MSWEEFIELRDLRSGREQVGLTRLPCSPPRLERANAVRISPGKVPDLLSRAGIIRVLSSA
QDPQLTEEKGEGHNFQPCSNAQPTWCDLCGDFIWGLYKQSLRCSNCRFTCHYRCRALIRL
DCIWDRGSVADHMCVVEHTVETDTNVDEQVECVKEELTTAELQQKVKEYNAQVNSNLFMN
SNKDGSYTGFIKVQFKLARPVSVTPPKKGGHDSKGKKGGGVKRRTSFYLPKDASKHLHIS
SRTSSREVIEALLKKFTVVDNPAKFALFERSERHDQVYIRKLSDRERPLRLRLNAGPNEK
VLSFVLKENETGEVNWHAFSMPELKNFLRILQREEEEHIKQIVQRYALARTRMQDALAGS
TPG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtcttgggaggagtttatcgagctccgtgacctcaggtcaggtcgagagcaggtaggc
ctaacaaggttgccatgctcgccaccgcgcctggagagggccaacgccgtgaggataagc
cccgggaaggtcccagacctgctgagcagggcgggcatcatcagggtcctgagcagtgcc
caggacccccagctgaccgaggagaagggagagggacacaacttccagccctgcagcaac
gctcagcccacatggtgcgacctgtgtggggacttcatctggggcctgtacaagcagagc
ctgcgctgctccaactgcagattcacatgccactaccgctgccgcgccctgatccgcctg
gactgcatctgggaccgaggctccgtggccgaccacatgtgcgtcgtggagcacaccgtg
gagacggatacgaacgtggacgaacaagttgaatgtgtgaaggaagagttgaccactgca
gagcttcagcagaaggtgaaggaatataatgctcaagtcaacagcaatctcttcatgaat
tcaaacaaagatggttcctacactggtttcataaaagtgcagttcaagttggcgagaccg
gtgtctgtcacgccacctaagaaaggaggtcatgacagcaaagggaagaagggaggcgga
gttaaacgtcgcacttctttctacctgccaaaggacgcgtccaagcacctgcacattagc
tcgcggacatcctctcgggaggtcatcgaggctctgctgaagaagttcaccgtggtcgac
aatcctgccaagtttgccctgtttgagcgcagcgagcgccacgaccaagtttacatcagg
aagctgtctgaccgcgagcgccccctccgtctgcggctgaatgctggacccaacgagaaa
gtcctgagtttcgttctgaaagagaatgaaactggagaagtcaattggcacgccttctct
atgcctgagctgaagaacttcctccgcattctgcagcgcgaagaagaggaacacatcaag
cagatcgtgcagcgttacgccctggcccgcaccaggatgcaggacgccctggcgggctcc
actcctggctga

DBGET integrated database retrieval system