KEGG   Takifugu rubripes (torafugu): 101063302Help
Entry
101063302         CDS       T02386                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00240  Pyrimidine metabolism
tru00983  Drug metabolism - other enzymes
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101063302 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101063302 (tk1)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101063302 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK ATPase_2 Ribosomal_L40e
Motif
Other DBs
NCBI-GeneID: 101063302
NCBI-ProteinID: XP_003972121
UniProt: H2U878
LinkDB All DBs
Position
17
AA seq 231 aa AA seqDB search
MELGGFSKILPNSPKNARGQIQVIFGPMFSGKSTELMRRVRRFQLAQYKCLVIKYAKDTR
YSDSGMATHDKNTMEAVPANRLGDVHSQALQVCVIGVDEGQFFPDIVEFCEEMANLGKTI
IVAALDGTFQRKPFGSILNLVPLAESVVKLNAVCMQCFKEAAYTKRIGAEKEVEVIGGAD
KYQAVCRKCYGDLMVDKENRSPCSDETPPHDHLEKLKDSAVPRKLFSSVIL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggagttaggcggattttcaaagattcttccaaattcaccgaaaaacgcacggggacag
attcaggtcatatttggaccgatgttttccggcaaaagcacagagttaatgcgaagagtg
cgtcgtttccagctggcccagtacaaatgcttggtgatcaaatatgccaaggacacgcgt
tattctgacagcggcatggccacacatgacaagaatacaatggaggctgttccagccaat
cgccttggagatgtgcactctcaggcgttgcaagtctgtgtcattggagttgacgaagga
cagttttttccagacatcgtggagttttgtgaggagatggccaatttgggaaagacaatc
attgtagctgctttggatggaaccttccagagaaagccatttggaagcatcctgaacctc
gtcccgcttgcagagagcgtggtaaagctcaacgcagtctgcatgcagtgttttaaagaa
gctgcctacaccaagaggatcggagcagagaaagaggtggaagtgatcggtggagcagac
aagtatcaggcggtgtgcaggaaatgttacggagatctgatggtggacaaggagaacagg
tctccctgtagcgatgaaaccccaccacacgatcaccttgaaaaactaaaggactctgct
gttcccaggaagcttttctccagtgtcatcctctga

DBGET integrated database retrieval system