KEGG   Takifugu rubripes (torafugu): 101064574
Entry
101064574         CDS       T02386                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04020  Calcium signaling pathway
tru04260  Cardiac muscle contraction
tru04261  Adrenergic signaling in cardiomyocytes
tru04270  Vascular smooth muscle contraction
tru04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101064574 (cacna1c)
   04020 Calcium signaling pathway
    101064574 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101064574 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101064574 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    101064574 (cacna1c)
   04270 Vascular smooth muscle contraction
    101064574 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tru04040]
    101064574 (cacna1c)
Ion channels [BR:tru04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101064574 (cacna1c)
SSDB
Motif
Pfam: Ion_trans GPHH CAC1F_C Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 101064574
NCBI-ProteinID: XP_029681654
LinkDB
Position
18
AA seq 2348 aa
MVNESKNMYIPEDTLENHQGSDYSPPPPLPRPPPQGLTNEHSGGVSHGDHDGRGGGGGVN
HGLGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAASSGGAGLGSGGGGPISTASST
QRKRQHYSSKPKKPTTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANC
VALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLL
DFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVL
NSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYKQPKSLSEEKPAPCAPEG
AYGRHCKRNGTVCLMEWDGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYE
LPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLD
WITQAEDIDPENEEEGLDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTRLANRISK
SKFSRYSRRWNRLFRRKCRAGVKSQVFYWLVIFLVFLNTLTIASEHHHQPQWLTDVQDIA
NKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVL
RCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNF
EETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPAFPGMLVCIYFIILFICGN
YILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARLASPEKRHNNEKPPLEEEKKE
KIELKSITTDGEANTATKIHMDDYCGDDSEEKNPYPANDYIGEDDEDEPEMPVGPRPRPL
SDIQLKEKVVPMPEARAFFVFSHTNKFRITCHKIVNHNIFTNLILFFILLSSISLAAEDP
VKNDSSRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLI
SSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFM
FACIGVQLFKGKFFLCTDSSKQTQAECRGSYIMYKDGDVGKPERAQRLWENSEFNFDNVL
QGMMALFAVSTFEGWPGLLYRAIDSVAEDFGPIYNYRVIISIFFIIYIIIIAFFMMNIFV
GFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFE
YLMFTLILLNTICLAMQHHGQTKSFNNAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDP
WNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGSIVDIAITEVNPADSSASSSS
SSSSSSSSPSSSHPPVVRPMVRSDGNLVRLPVSSSTIPPPLSTSIAPSMNSEENARISIT
FFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIA
LRDNTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACTLNRPCEKGSTNETNQSTEDC
GSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVR
TALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVAKVPPKTTLSLQAGLRTLHDIGPEIRRAISGDLTVEEELDKGLKEPV
SAASEDDIFRVKRTGGLFSNHVNYYNQSDGRSSFPQSFTTQRPLHISQKGSPCEAESPSH
EKLMDSTTFTPSSYSSSGSNANINNANNTSVGGVTTQGISRYPSPSISTVDGHTGQPLTP
ILLPKSSWCFPPKRTCFYDSLMRSDSSDSRLPIIRRGEGSMEETYDESYTDDREYQEDNH
SLSSDMLVYHDETCKQLTPMEEGEEVEHRRGGVWQSPRRVFLCPTSLVRRSSFHLECLRR
QSRPDVSQKTAVPLHLVHHQALAVAGLSPQLRRSHSPTLFSRLCSTPPASPTAHGSGASY
QQVPSLRLEGSNSHEKLNTSLPSVNCGPWYSDSNGNSRVPSPSPSVSVSAQRPARPLSLT
VPSLLGKDNSSLTHGSAGSLVEAVLISEGLGEFAQDPSFIEVTKAELADACEMTIEEMEQ
AANNILNGNTTTTTTSSTSSTSQHSPNGNFLPFHAAAAVAVAAAAATHRDQVVADGGEEA
GGSRGSVHGPSSVEERQVLLVGGRSQEEMEEEEEEEEAEAEEGFEIGGARQRNSGLLEDE
DMECVTSL
NT seq 7047 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacatcccggaggacacccttgagaaccatcaaggc
tccgactattctccccctcccccgcttcctcggcctcctccccaaggccttaccaatgag
cacagtggcggcgtcagccacggcgaccacgatggaaggggaggaggaggaggcgtcaat
cacgggctgggcgtggtgggcttggcccctgagcatattcccacaccaggggcagcgctg
agctggcaagcagccatcgatgcggcgcgacaggcgaagatgatggggaacgctgcatcg
agtggaggtgcggggctcgggtcgggagggggcgggcccatctccacggccagttccacg
caaaggaagagacagcactacagctcaaagcccaagaaaccgaccacgaccaccgccacg
aggccgccacgggcactgctgtgcctaacgctcaagaaccccatccgcagggcctgcatc
agcatcgtggagtggaaaccatttgagatcatcatcctgatgaccatctttgccaactgt
gtggccttagccgtctacatccctttccccgaagatgactcgaacgccaccaactccaac
ctggaacgcgtggagtatctgttcctcattatttttacagtggaggcgttcctgaaggta
atagcctacggcttgctcttccacccaaacgcctacctgaggaacggctggaatctgctg
gacttcatcatcgtagttgtagggttgttcagtgcgatcctggagcaagccaccaagggg
gatggcgccacccccatcggagggaaggcggcgggcttcgatgtcaaggctctgagggca
ttcagagtgctcagacctctgagactggtgtctggagtacccagtttacaggtggtgctg
aactccataatcaaagccatggttcctctgctccacatcgccctgctggtcctgttcgtc
atcattatctacgccatcatcggcctggagctcttcatgggcaagatgcataagacctgc
tattacaagcaaccaaaatccctctcagaggaaaagccagcgccctgcgcacccgagggg
gcctacggccgacactgtaagcgcaacggcaccgtgtgcttaatggaatgggacggcccc
aacgacggcatcaccaactttgacaactttgccttcgccatgctaacggtgttccagtgc
atcaccatggagggctggaccgacgtgctgtactggatgcaggatgctatgggctatgag
ctgccgtgggtctattttgtctctctcgtcatctttggctcctttttcgttctcaatctc
gttctgggtgtgttgagcggagagttttccaaggagagggagaaggcgaaggcccgtggc
gacttccagaaactcagagaaaagcaacaactcgaagaggacctcaagggctatctagac
tggatcacccaggctgaggatattgacccagagaatgaagaggagggcttggatgacgac
aaacccagaaacctgagcatgccagccagcgagaatgaatcagtcaacacagacaacgct
cccggcggggacgtggagggggaaacctgctgcacccggctagcaaataggatctccaaa
tccaagttcagtcggtactctcgcaggtggaacagactgttcaggaggaagtgccgggcg
ggggtcaagtcacaggttttctactggctggtcatcttcctggtcttcctcaacacgctg
accatcgcctctgaacatcaccatcagcctcagtggttaacagacgttcaagatatagcc
aacaaggtgctgctagcactcttcactggtgagatgctgttgaagatgtacagtctgggc
ctgcaagcgtactttgtctcgctctttaatcgcttcgacagctttgttgtgtgtggaggg
attctggaaaccatcctggtggaaaccaagatcatgtctcctctcggcatctccgtgtta
cgttgtgtgcgcttgctgcgaatcttcaaaataacaagatattggaactctctgtccaac
ctggtggcgtctctgctgaattctgtccgctccatcgcttccctgctgctcctgctcttc
ctcttcatcatcatcttctccctcctcggcatgcagctgttcggcgggaaattcaacttc
gaagagacgcgacgcagcacctttgacaactttccccagtctctgctcaccgtgtttcag
atactgacaggagaggattggaactctgtgatgtacgacggcatcatggcgtatggtgga
cctgctttccccggcatgctggtgtgcatctacttcatcatcctcttcatctgtgggaac
tatattcttctgaatgtcttcttggccatcgctgtcgacaatctggcagacgctgagagc
ctaacatctgcccagaaagaagaggaagaagagaaggagaggaagaaactggccaggttg
gccagcccagagaagcgtcacaacaacgaaaaacctcccttggaggaggagaagaaggag
aagatcgagttaaagtccatcaccaccgatggagaagctaacacggctactaagatccac
atggatgattattgtggagatgacagcgaagaaaagaacccatatccagccaatgattac
ataggggaagatgacgaagacgagccggagatgccagtgggccccaggccgcgaccgctc
tccgacattcagctgaaggagaaggtggtccccatgccggaggcccgcgccttcttcgtc
ttcagccacaccaacaaattcaggatcacgtgccataagatcgtcaaccacaacatcttc
acgaacctcatcctcttcttcatcctgctcagcagcatcagtctggcggcggaggacccg
gttaagaacgactcctccagaaaccagatcctcggctatgcagaccacgtcttcactggg
ctcttcaccatagagatcattctaaagatgaccgcctatggagcgttcctccataaaggc
tccttctgcaggaactatttcaatattctggacctggtggtggtcagcgtgtccctcatc
tcctctggaatacagtccagcgcgatcaatgtggtgaaaatcctgcgagtgctgcgggtg
ctcaggccactgagggccatcaacagagctaagggattaaagcatgtggtgcagtgcgtg
tttgtggccatcaggaccatcggcaacatcgtcatcgtcaccacgttgctccagtttatg
tttgcctgcattggcgtgcagctcttcaagggcaagttcttcttgtgcaccgacagctct
aagcaaactcaggctgagtgcaggggttcctacatcatgtataaggatggagatgtcggg
aaaccggaaagggcccagagactatgggagaacagcgaatttaacttcgacaatgttctg
caaggcatgatggcgctgttcgccgtgtccacctttgaggggtggccagggctactctac
cgagccattgactccgtggcagaggacttcgggcccatctacaactaccgcgtgatcatc
tccatcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtt
ggtttcgtcattgtcacgttccaggagcaaggagagcaagagtataagaactgtgaactc
gacaagaaccagcgtcagtgtgtggagtacgctctaaaggcgcgcccgctgcggcgctac
atccccaagaacccttatcagtacaaggtgtggtacgtggtcaactccacctactttgag
tacctgatgttcacactcatccttctcaacaccatctgtctggccatgcagcatcacgga
cagaccaaaagcttcaacaatgccatgaacatcctcaatatgctcttcactggactcttc
accgtggaaatgatcctcaaactgattgccttcaaacccagggggtactttagtgatccc
tggaatgtctttgatttcctcatcgtaattggcagcattattgacgtcattctcagtgag
atcaaccattattttgttgatgcatggaacacatttgatgccttgatagttgtgggtagc
attgttgacatagcgatcactgaggttaacccagctgactcctccgcgtcttcgtcgtcc
tcctcttcgtcctcctcctcctccccttcatcctctcacccccctgtggtaaggccaatg
gtacgctccgatggtaacctcgtacgcctccccgtctcctcctccaccatccctccgccc
ttaagcacttccatcgctccatctatgaactctgaagagaacgccaggatctccatcacc
ttcttccggctgttccgcgtgatgaggctggtgaagctgctgtctcgcggggaagggatt
cggaccctgctgtggaccttcatcaaatctttccaagcactgccctacgtagctctgctt
atagtgatgctattcttcatatatgcagtcatcggcatgcagatgtttggtaagatagcg
ctgcgggacaacacgcagatcaacaggaacaacaatttccagactttccctcaggcagtg
ctgctgctgttcaggtgcgcaacaggtgaagcctggcaggagatcatgctggcctgcacg
ctcaatcggccttgcgagaaaggatcgaccaatgagaccaaccagtccaccgaggactgc
ggcagccagtttgccatcatttattttgtcagcttctacatgctctgtgccttcctgatc
attaatctgtttgtggctgtcatcatggacaactttgactacctgacacgcgattggtca
atcctggggccgcatcacctggatgagttcaagaggatctgggctgaatatgaccctgaa
gctaagggaaggataaagcacttggacgtggtgactctgctgaggagaatacaaccccct
cttggctttggaaagctctgtccacacagggtggcctgcaagcgtcttgtgtcgatgaac
atgcctctaaacagcgatggcactgtaatgttcaacgcaacgctgtttgctttggttcga
actgcactgaggatcaagacagaggggaacctggagcaggccaacgaggagttgagagca
attgtgaagaagatctggaagagaaccagcatgaagctccttgatcaagtagtgccccct
gctggcgatgatgaagtaacagtcgggaagttctacgccacctttctcatccaggaatat
ttccgcaagtttaagaagagaaaagaacaagggctggttgccaaggtgcccccaaaaacg
accctttctctgcaggcgggcctgcggacattgcacgacatcggtcctgagattcggagg
gccatctccggggacttgacggttgaggaggagctggacaaagggttgaaggagcctgtg
tcggccgcatccgaggacgatatcttcagggtaaagaggacaggtgggctatttagcaac
catgtcaactactacaaccagagcgatggccgcagttccttcccgcagtcctttaccacc
cagcgtcccttgcacatcagtcaaaaaggctccccctgtgaagccgagagcccctctcac
gagaagctcatggactccaccacgttcaccccgtcctcgtattcttcgtccggctccaac
gccaacatcaacaacgccaacaacacgagcgtgggcggggtcaccacgcagggcatcagc
cgctacccgagcccgtccataagcaccgtggacggacacacaggacagccgctcaccccc
atcctgctgccaaaatcctcctggtgctttcctccaaagaggacgtgtttttatgactct
ctcatgcgctcggattccagcgacagccgcctgccaatcatccgaaggggcgaaggctcg
atggaggagacgtacgacgagagctacaccgatgacagggagtaccaggaagacaaccac
tcactctcctccgacatgctggtgtatcatgacgagacatgtaaacagttgactcccatg
gaggaaggagaagaggtggagcacaggagaggaggggtgtggcagtctcccaggagagtc
tttctgtgccccacttccctggtccggaggtcgtctttccacctggagtgtctcaggcga
cagtcgaggccagatgtgtcccagaagacggccgtgcccttacaccttgtacatcatcag
gctctggcagtcgcagggttgagtcctcagctgaggaggagtcactcgcccaccctcttc
agccggctgtgttccacgcctccagccagtcccacagcccatggtagcggtgcctcctac
cagcaagtaccctctctaagattagagggctccaactcccatgaaaagctcaacaccagc
ttgccctccgtgaattgcgggccttggtatagtgacagtaatgggaacagcagagtgccc
agtccgagccccagcgtgtctgtgtctgctcaaagaccagcgcggccactgtcgctcacg
gtgccctcgctgcttgggaaggacaacagctcgctgactcacggcagcgcaggcagtctg
gtggaagcggtgctaatatcagaggggttgggtgagttcgcccaggacccgtcgttcatc
gaggtgaccaaagctgagctggccgacgcctgcgaaatgaccatcgaggagatggaacag
gccgccaacaacatcctgaatggcaacaccaccaccaccaccacatccagcacctcctcc
acctcccagcacagcccgaatggcaacttcctccccttccatgcggcagcagcagtggcg
gtggcggcggcggcagcaacgcacagggaccaagtggtcgccgatggcggggaagaggcc
ggaggtagcagaggctccgtccacgggccttcctcagtagaggagcgacaagtgctgcta
gtgggggggaggagtcaagaagagatggaggaggaggaggaggaggaggaggctgaagcg
gaggaagggtttgagattggaggagcacggcagaggaacagcgggctcttggaggacgag
gatatggaatgtgtgaccagcttgtag

DBGET integrated database retrieval system