KEGG   Takifugu rubripes (torafugu): 101067059Help
Entry
101067059         CDS       T02386                                 

Definition
(RefSeq) neurogenic locus notch homolog protein 1-like
  KO
K02599  Notch 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101067059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Ank Notch DUF3454 NOD NODP Ank_5 Ank_3 Ank_4 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 101067059
NCBI-ProteinID: XP_003975158
LinkDB All DBs
Position
21
AA seq 2513 aa AA seqDB search
MYIFFVKLTFLLWLIARAKGLRCSMPLEPCLNQGKCEATLDGNGQCRCTDGYLGSSCQFP
DPCTTLPCKNGGTCRSVTNGNTVDFNCTCKLGFTDHNCQTPIINACISSPCLNGGTCELE
TLQTYKCRCPPGWSGKLCQQADPCASNPCANGGHCSAIESHYVCTCTPFFSGKTCKQDVN
ECDVSPSLCKNDGVCINDVGGYRCKCPAEYTGKHCDSRYLPCSPSPCHNGGTCIQKGETS
YDCSCVPGFTGKNCDNNIDDCPGHECQNGGTCVDGVNTYNCQCNPEFTGQLCTEDVDECQ
LMPNACQNGGTCHNTYGSYQCVCVNGWTGNDCSENIDDCASAACYQGSTCHDRVASFYCE
CPHGRTGLLCHVDDACMSNPCQKGSNCDTSPVSGNHICTCPTGYIGASCNQDVDECSLGP
NPCEHAGKCINTKGSFQCKCQRGYMGPRCELDINECISNPCMNEATCLDKIGGFRCICMA
GYTGEFCEIDTNECANSPCLNSGTCIDKINAFHCQCPTGFTGNLCQIDIDECASTPCKNG
AKCTDGPNKYTCECTEGYSGRHCETDINECYSDPCHYGTCIDGLASFSCQCKPGYTGRLC
ETNINECLSQPCRNGGTCQDRENAYICSCPKGTTGINCEINIDDCKSNPCDYGTCIDKIN
GYECACEPGYTGMMCNINIDECATNPCHNGGTCIDGINSFTCVCPEGYHDATCFSQVNEC
LSNPCIHGHCEDKINGYKCLCDSGWSGKNCDINNNECESNPCMNGGTCKDMTSGYVCTCR
MGFTGPNCQTNINECASNPCLNHGTCIDDVAGYKCNCILPYTGVNCETLMAPCSSEPCKR
GGVCQESEDYQNFSCVCPEGWQGQTCEVDIKECVNSPCLNGATCKDTLGSYRCNCKPGFT
GRNCETNINDCNPNPCGNGGACVDEANSFLCICLPGFRGTKCEEDINECESNPCKNGANC
TDCVNSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCLCPSGFTGNYCQH
DINECDSKPCLNGGTCQDSYGTYKCTCLHGYTGLNCQNLVRWCDSSPCKNGGTCWQTGTT
YSCGCETGWMGLYCDVPSVSCEVAAKQRGVDVAQLCRNSGQCLDAGNVHHCLCQVGYTGS
YCEEQVDECTPNPCQNGATCTDFLGGYSCKCMPGYVGTNCSDEINECFSQPCQNGGTCID
LINTYKCSCPRGTQGVHCEINIDDCNPFFDPITKEPKCFNKGKCVDQVGGYQCICPSGYV
GERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQHCDTVFDGCTGTRCRNGG
TCAVASNTPHGFICKCPPGFSGATCDYDAKACGSLNCRNGGTCISGSKSPKCLCMPAFTG
PECQYPTDTPCNSNPCYNGGTCQYISEAPFYHCACPTNFNGLRCHILDYSFPGGFGHDIT
PQSEVEVKCENPQCETLKHNRVCDAHCNNHECGWDKGDCSLNFNDPWKNCLASLQCWRYF
NNGKCDSQCNNAGCLYDGFDCQNLEGQCNPLYDQYCKDHYADGHCDQGCNNAECEWDGLD
CANNVPKKLAVGQLILVVHVAPEHLLNNSFGFLRELSRVLRTNMIIRKDGKGELMVYPYY
GEEHELKKYNVKRSVDNWSEVPGQVLNRVKKSLYDVAGRSKRRRRELDHLQVKGSVVHLE
MDNRQCFQQSTECFQSTNDAAAFLGALASSFKLDVPYTIEAVYSDVDLQPQQELYPIYLV
LAGIGMLAFLGVGMVAARKRRHEHGRLWLPEGFKTTETSKKKRREPVGEDSVGLKQLKNT
SDISLMDVTHNDWEDDKHSDAKRFRQIDEQAILEADDQTDHRQWTQQHLDAADLRVPSIA
PTPPQGEIESDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGA
NLHNQTDRTGETALHLAARYARSDAAKRLLEASADANIQDNMGRTPLHAAVAADAQGVFQ
ILIRNRATDLDARMHDGTTPLILAARLAVEGMVEELINCHADVNAADDFGKSALHWAAAV
NNVEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANREITDHMERLPR
DIAQERMHHDIVRLMDEYNLVQSPHMHAGSLGTTLSPPLCSPNGYLGGIKQHPPQGQGQG
KKSRKPSIKGIACKDGKDMKVKKKNSQDGKSGNLLDSSAVLSPVDSLESPHGYVSDVASP
PMMTSPFQQSPSVSLNHLQGMSDPHLTVNHMVMPNKQELARMQFDPLPPRLTHMPVSNSS
GQGAMNGHCDWLSRMHPNMSQPSQFNPLRGALSGQGGLHQAGQHALMTSLRNGHPTTSLS
QIMNYQGLQSSRLGPQSHISPQQMQQMQNLQQLQQQQNVQLQHQNSNTTNGQSFIGGELS
SPEIQQGTANPSIPIHTILPQETQIMTSTLSQSMASTQFLTPPSQHSYSGPIDNTPNHQV
QVADHPFLTPSPGSPDQWSSSSPHSNMSDWSEGISSPPTSMQSQMGPIPEQFK
NT seq 7542 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattttttgttaaactaactttcttgttgtggctgatagcgcgtgcaaaaggt
ctaagatgctccatgcctttggagccttgtttgaaccaggggaagtgtgaagcaactctg
gatggaaacggacagtgcaggtgcacagatggatatctgggaagcagctgccagtttcct
gacccatgcacaaccttgccgtgcaagaatgggggcacttgtcgctctgtaaccaatgga
aatacagtggacttcaactgcacctgtaaactaggctttactgaccacaactgccagaca
cccattatcaatgcctgcatcagctcgccttgtcttaatggaggcacctgtgagctggag
accctccagacatacaagtgccgctgcccacctgggtggtcaggaaaactttgccagcaa
gctgatccctgtgcctcaaatccttgtgccaatggtggccactgctctgccatcgagtcc
cactatgtctgtacctgcacgcccttcttctcaggaaagacctgcaaacaggatgtcaac
gagtgcgatgtgagcccgtcactgtgcaagaatgacggtgtgtgcataaatgatgtgggt
ggctaccgatgcaagtgccccgcagagtacacgggcaagcactgcgatagtcggtacctg
ccctgcagtccatcaccctgccataacggaggcacgtgcatacagaaaggagagaccagc
tatgactgctcctgtgtgccaggttttacaggcaaaaactgtgacaacaacatcgatgac
tgtcccggtcacgagtgccaaaatggaggaacatgcgtcgatggagtcaacacctacaac
tgccagtgtaacccagaattcacaggacagctttgcacggaggatgttgatgagtgccag
ctgatgcccaatgcctgccaaaacgggggcacgtgtcacaacacttatggaagctaccag
tgtgtgtgcgtgaatggctggactgggaatgactgcagtgagaacattgatgattgtgcc
agtgctgcgtgctaccagggatccacctgtcatgaccgagtagcttctttttactgtgaa
tgcccccatggccgcacaggactgctgtgtcacgtggatgacgcctgcatgagcaatccc
tgtcaaaaaggctccaactgtgacaccagcccagtgagcggaaatcacatctgtacctgc
ccgacaggatacattggtgcctcctgcaaccaagacgttgatgaatgctcactgggccct
aacccatgtgagcatgctgggaagtgcataaacaccaagggttcgttccagtgtaagtgc
cagcggggttacatggggccgcgttgtgagttggatatcaacgagtgtatttccaacccg
tgcatgaatgaggccacctgcctggacaaaataggaggctttcgctgcatttgtatggca
ggttacacaggggaattctgtgagatcgataccaacgagtgcgccaacagcccctgcctg
aacagcggcacatgcatcgacaagatcaatgcctttcactgccaatgccccacaggcttt
acagggaacctttgccagatagacattgatgaatgtgccagcacaccctgcaaaaatggc
gccaaatgcacagatgggcctaacaagtatacctgcgagtgcactgaaggttactctggc
agacactgtgagacagatatcaacgaatgctactcagacccgtgccactatggaacctgc
atcgatgggctggcatcgtttagctgccagtgtaaacctggatacacgggccgactgtgt
gagaccaacatcaacgagtgtctaagccagccctgcagaaatggcggaacctgtcaggac
cgagagaatgcctatatttgtagctgccctaaaggcaccacaggaatcaactgcgaaatc
aacattgatgactgcaaaagcaatccctgcgactatggaacctgcattgacaaaatcaat
gggtacgagtgtgcctgtgaacctggctacacagggatgatgtgtaacatcaacatcgat
gaatgtgccaccaacccgtgtcacaatggcggcacttgtattgacggcatcaacagcttc
acctgcgtgtgtcccgaaggttaccatgacgccacgtgcttctcccaggtgaatgagtgc
ctcagcaatccctgcatccacggtcattgtgaggacaagattaatggctacaaatgcctc
tgtgactctggctggagcggcaaaaactgcgatatcaataataatgagtgtgagtccaac
ccatgtatgaatggaggtacctgcaaagacatgaccagcggatatgtttgcacttgtcgg
atgggattcactggcccaaactgccagactaatatcaatgaatgtgcctccaatccgtgc
ctgaaccatgggacctgcattgatgacgttgccgggtacaagtgcaactgcatccttcct
tacacaggagtgaactgtgaaacgctgatggcgccttgcagcagtgaaccctgcaaacgt
ggaggagtgtgtcaggagtcagaagactatcagaacttttcctgtgtctgtcctgaagga
tggcagggtcaaacatgtgaagtggacataaaggaatgtgttaatagtccctgtctcaat
ggagcaacctgcaaggacactttgggaagctatcgctgtaactgcaaacctggttttact
ggacgtaactgcgaaactaacatcaatgactgcaaccccaacccttgcggcaacggaggc
gcctgtgtggacgaagcgaacagcttcctgtgtatctgcctgccaggatttcgaggcaca
aagtgtgaggaagacatcaatgagtgtgagagcaacccctgcaagaatggagccaactgc
acagactgtgtcaacagttacacctgtacctgccccgctggcttcagtggaatccactgt
gaaaacaacacacccgactgtaccgagagctcctgctttaacggtggcacctgtgtggat
ggtatcaatacctttacgtgtttatgcccatcggggtttactggtaactactgccagcac
gatatcaatgagtgtgactccaaaccttgcctaaatgggggcacctgccaggatagctac
ggtacctacaagtgtacctgcttacatggatacactggcctcaactgtcagaatttggtc
cggtggtgcgactcatcgccctgtaagaatgggggaacttgctggcaaacaggaaccact
tacagctgtgggtgtgagaccggctggatgggactttactgtgacgtcccaagtgtttcc
tgtgaggtggctgccaaacagagaggagtggatgttgcccaactctgtcgaaattcaggt
cagtgtctggatgcaggaaatgttcatcactgcctctgccaggttggatatactggaagt
tactgcgaagagcaggtggatgaatgtactccaaatccctgtcagaatggcgctacctgc
actgactttctaggcggatacagctgcaagtgcatgccaggatatgtggggaccaactgc
tctgacgagatcaatgaatgtttctcccagccatgccagaacgggggcacctgcattgac
ctgatcaatacctacaaatgctcctgtccccggggaacccaaggtgtgcactgtgaaatc
aacatcgatgactgtaacccgttctttgacccgatcaccaaagaaccaaagtgtttcaac
aaaggcaagtgtgtggatcaggtcggagggtatcagtgcatctgcccctcggggtatgtc
ggggagcgttgtgagggagacgtaaatgaatgcctctccaacccctgtgacccccgaggc
acacacagctgcatccaacttaccaacaactaccgctgcgagtgtcgcaccggatacaca
ggtcagcactgtgacactgtgtttgacggatgtacgggaacacgctgtcggaacggaggg
acctgtgctgttgccagcaacaccccacacggcttcatctgcaaatgtcctccagggttt
agtggagccacgtgtgattatgatgctaaagcatgcggcagcctcaactgccgtaacgga
ggcacctgcatctctggcagcaagagtccgaagtgtctgtgtatgccagcctttactggg
cctgagtgtcagtatcccactgacactccctgtaattccaacccctgttacaacggtggc
acgtgtcaatacatatccgaggcgccgttctaccactgcgcctgtccgacgaactttaac
ggcctccgatgccacatcctggattacagcttcccgggagggttcggccacgacatcaca
ccgcagtcagaggtggaggtcaagtgcgagaacccgcagtgcgaaactttaaaacacaac
agggtctgtgatgcccactgtaacaaccatgagtgcggctgggacaagggcgactgctcc
ctcaacttcaacgacccgtggaagaactgcttggcctcgctgcagtgctggcgatacttt
aataatggcaaatgcgattcgcagtgcaacaacgccggatgcctatatgatggttttgac
tgtcagaatctggagggacagtgcaatcctctgtatgaccagtattgcaaggaccactac
gctgacggccactgtgaccaaggctgcaacaatgctgagtgtgagtgggatggtttagat
tgtgccaataatgttcccaagaagctcgctgttggccagttaatcctggtagtccacgtc
gctcccgaacatctcctgaacaactcttttggcttcctgcgtgagctcagccgcgtcctg
cggaccaatatgataataaggaaagatggcaaaggcgagctgatggtgtacccgtactac
ggggaagaacacgagctgaagaagtacaacgtgaagcgttcagtggacaactggtcagaa
gtccctggacaggtgctgaatagggtaaagaaaagcttgtatgatgtggctggtcggagc
aaaagaaggaggagggagctggatcatttgcaggtcaaaggctctgtggttcacttggag
atggacaaccgtcagtgcttccagcagtccactgagtgcttccagagcaccaacgatgcc
gccgcgttcctcggagcactggcatccagtttcaaactggatgttccctacactattgaa
gctgtttatagtgatgtggaccttcagccgcaacaagagctttatccaatctacttggtc
ctagctggcatagggatgctggcctttcttggagtgggaatggtggctgcccgaaagcgt
cgtcacgagcatgggcgtctctggcttcccgaaggcttcaagaccactgagacaagcaag
aagaagcgacgggagcctgtcggagaggattccgtgggattaaagcaattgaaaaacact
tccgacatttcactcatggatgttacccacaatgactgggaagacgacaagcattccgat
gccaaacgcttcaggcaaatcgatgaacaggcaatcctggaggctgacgaccaaacggac
catcgccagtggactcagcagcacctggatgctgctgacctgcgcgtcccctccatcgca
ccgactccacctcagggcgagattgagagcgactgcatggacgtgaatgtccggggacca
gatgggttcacgccattgatgattgcatcctgcagcgggggaggtttagaaacaggcaac
agtgaggaagaagaggatgcttcagccaatgtgataaatgactttatctaccagggcgct
aaccttcacaaccagacagaccgcacaggtgaaacagctctgcatctcgctgctcgctac
gcgcgttccgatgccgccaagcgccttctggaagccagtgctgatgccaacattcaggac
aacatgggaaggacgcctctccatgctgcggtggcagctgatgcccagggggtgttccag
attctgataaggaatcgtgccacggacttggatgcccgcatgcatgacggtacgactccc
ctgattttagcggccaggctggcagtggaaggcatggttgaagagctcattaactgtcat
gccgatgtcaatgcagctgatgattttggtaaatctgctctgcactgggctgcggcagta
aacaacgtggaggctgcagttgtgcttctcaagaacggggcaaacaaggacatgcaaaac
aataaggaggaaacccctctattcttggctgctcgggaaggaagctacgagactgccaag
gtcttgttggaccactttgcaaacagagagataactgaccacatggagcgactgcctaga
gacatcgcacaggagagaatgcatcacgacattgtacggctaatggatgagtacaacttg
gtacagagccctcacatgcacgcaggatcgctcggcaccacgttgtcaccccctctttgc
tcccccaacggctacctaggtggcataaagcaacacccacctcaaggtcaaggccagggg
aaaaaatcacggaagcccagcatcaaaggcattgcctgcaaagatggcaaagatatgaag
gtgaagaaaaagaattcacaggatgggaagtctgggaacctcctggacagctcagctgtt
ctgtcaccggtggattcactggagtctccacacggctatgtctctgatgttgcctcccca
cccatgatgacctcacccttccagcagtcaccatctgtttccttgaaccatctgcagggt
atgtctgacccacacctcactgtaaaccacatggtgatgccaaacaagcaggaactcgct
cgaatgcagttcgaccctctgccgccgcgcctcacccacatgcccgtgtctaactccagt
ggccaaggtgccatgaacggccactgtgattggttatccaggatgcaccctaacatgagc
cagcccagccagttcaaccccctgagaggagctctgagtggtcagggaggtttgcaccag
gcagggcagcacgcgttgatgacctccctccgtaatggccaccccaccaccagcctgtct
cagataatgaactatcaggggcttcagagctccagactgggtccgcagtcccacatcagt
ccgcagcagatgcaacagatgcagaatctacaacagcttcagcagcaacagaatgttcaa
ctgcagcaccagaactcaaatacgaccaacggccagagcttcatcggaggggagcttagt
tccccagagatccagcagggaacggccaaccccagcattcccatccacaccatcctccca
caggagacgcagattatgacttctaccctcagtcagtcaatggccagcacacagttcctc
accccaccctcccagcacagctattccggtcccatagacaacactccaaaccatcaggtc
caagtggctgatcatccttttctaacaccttcccccggttctccagatcagtggtcaagc
tcttctcctcattccaacatgtccgactggtcagagggcatttcgagtccaccgacaagc
atgcagtctcagatgggacctataccagaacagttcaaataa

DBGET integrated database retrieval system