KEGG   Takifugu rubripes (torafugu): 101067705Help
Entry
101067705         CDS       T02386                                 

Gene name
hk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00010  Glycolysis / Gluconeogenesis
tru00051  Fructose and mannose metabolism
tru00052  Galactose metabolism
tru00500  Starch and sucrose metabolism
tru00520  Amino sugar and nucleotide sugar metabolism
tru00524  Neomycin, kanamycin and gentamicin biosynthesis
tru01100  Metabolic pathways
tru01200  Carbon metabolism
tru04910  Insulin signaling pathway
Module
tru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tru_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101067705 (hk1)
   00051 Fructose and mannose metabolism
    101067705 (hk1)
   00052 Galactose metabolism
    101067705 (hk1)
   00500 Starch and sucrose metabolism
    101067705 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    101067705 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101067705 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101067705 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tru04131]
    101067705 (hk1)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101067705 (hk1)
Membrane trafficking [BR:tru04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101067705 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD Tenui_N
Motif
Other DBs
NCBI-GeneID: 101067705
NCBI-ProteinID: XP_003969509
LinkDB All DBs
Position
13
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDIMHQFRREMVKGLGRDTNPTAA
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYDTPEDIIH
GTGTKLFDHVAECLGDFMEKHNIKDKKLPVGFTFSFPCQQTKLDEGVLITWTKRFKASGV
EGMDVVKLLSKAIKKRGNYDAEIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRNIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAREGLLFEGRITPELLTRGKFETKHISAIEKSKEGLSKAKEILTRLG
VEPSTEDCIAVQHVCTIVSFRSANLIAAVLAGILLRLKENKGMTRLRTTIGIDGSLYKMH
PQYARRLHKTVRRLVPDIDVRFLLSESGSGKGAAMVTAVAYRLAEHSRQIAEILSEFRLT
TEQLLEVKHRMRNEIQNGLSKNTQDIATVKMLPTFVQSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGF
TFSFPCQQTSLDAGILVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAIVNDTVG
TMMTCAYEEPTCQVGLIAGTGSNACYMEEMKNVEMIDGEKGQMCVNMEWGAFGDNGCLDD
IRTEYDRMVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGTVSRRAAQLCGAGMAA
VVDKIRENRGLDHLNITVGVDGTLYKLHPHFSKIMHQTVKELAPQCNVNFLLSEDGSGKG
AALITAVGCRLRQELNNK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcacagctactagcttattacttcaccgaactcaaagatgaccaggtcaaa
aagattgataagtacttgtactccatgcgcttctctgatgaaacgttactggacatcatg
catcagtttcggagggaaatggtaaaaggactgggtcgagacacaaacccaactgctgcc
ctgaagatgctgcccacctttgtgcgttcaatccccgatggttcagaaaagggagatttt
atcgctctggatttgggaggcagcaacttcaggatcctccgtgttaaagtgagccacgag
aagaaacagaccgtccagatggagagtcaaatttatgacacgccagaggacatcattcat
ggcaccgggacaaaactgtttgaccatgtggcagagtgcctcggcgacttcatggaaaaa
cacaacatcaaagacaagaagcttcctgtggggttcaccttctccttcccctgccagcag
actaaactggatgagggcgtcctgataacctggacaaagcgcttcaaggccagtggagtg
gagggaatggacgtggtcaagctgctcagcaaagctattaagaaacgtggaaactatgat
gctgagatcatggcagtggtaaatgatactgtgggaacaatgatgacgtgtggatttgat
gaccaacgctgtgaagtaggaatcatcatcggcacgggcacaaatgcgtgctacatggaa
gagctgcgaaacattgacctggtggagggagacgagggcaggatgtgtgtgaacaccgag
tggggggcgtttggagacgatggcagactggaggacatcaggacagagtttgacagagaa
atcgacagaggctctctcaaccccggcaagcagctatttgagaagatggtcagtgggatg
tatctgggcgagttggtgcgtctcatactggtgaagatggccagagagggcctgctgttc
gagggcaggatcacgcccgagctgctcacgagaggcaagtttgagaccaaacacatctcg
gccattgagaagagtaaggaggggctgtcaaaggccaaagagatcctgaccagacttggg
gtggagccttcaactgaagactgcatcgctgtacagcatgtttgcaccattgtgtctttc
cgctctgccaacctgatagctgctgtcctggcaggcattctgctcagactaaaggagaac
aaaggtatgacacggttgaggaccaccataggcatcgatggatctctgtacaagatgcac
ccacagtacgcccgtcgcctccataagacagtccgtcgtttggtcccggatattgacgtt
cgattcctcctgtcagagagtgggagcggaaagggtgctgccatggtgacggcagtggct
taccgtctagccgagcattcgcgacagattgcggaaatactgtcagaatttaggctaacg
acagaacagctgctggaggtgaagcaccgaatgagaaatgagatacaaaatggcctttca
aagaacacacaggacattgctaccgtcaaaatgctgccaacctttgttcaaagcacacca
gatggcacagagaatggagacttcctggctttggatttaggaggaaccaacttcagagtt
ctcttggtcaagattcgttctgggaagagaagaacggtggagatgcacaataagatctat
gctattcctctggaagtgatgcagggcacaggagaggagttgtttgatcacatagtgcag
tgtatcagcgacttcctcgactacatgggcatgaagaacacccgtcttcctctgggattc
accttctccttcccctgtcaacagaccagcctggacgctggtatccttgttacatggact
aaaggattcaaggctacagactgtgaaggagaggatgtggttggactgctgagggaggct
attaagaggagagaggaatttgacctggatgtggtggctattgtgaatgatacagtggga
accatgatgacctgtgcctatgaggagcctacctgtcaggtcgggctgattgcaggcacc
gggagtaacgcctgttacatggaggagatgaagaatgttgagatgatagatggagaaaag
ggacagatgtgtgtcaatatggagtggggggctttcggagacaacggatgcctggatgac
atcaggacagagtacgaccgaatggtggatgacttctccctcaatccaggcaaacaaaga
tatgagaaaatgtgcagtggcatgtatctgggtgaaattgtgcgaaacatcctgatagat
atgaccaagagaggattcttgttccgagggcaaatttctgaaacactcaaaactagaggc
atctttgaaacaaagttcctctcacagatagagagtgacaggctggctttgctgcaggtg
agatccatcctgcaacacttggggctagacagcacctgtgatgacagtattatagtcaaa
gaggtgtgtggaaccgtgtcacggcgcgccgctcagttgtgcggcgcaggaatggcagct
gtcgtcgataaaatcagagagaaccgtggactggaccatctgaacatcacggtgggggtg
gacggcacgctctacaagctccatccccacttctccaagatcatgcaccagacagtaaag
gaactggcccctcagtgcaacgtcaactttctcttgtcagaggacggcagtggaaaaggg
gcagcactcatcacagctgtgggctgtcggctaagacaggagctaaacaataaatag

DBGET integrated database retrieval system