KEGG   Takifugu rubripes (torafugu): 101068411
Entry
101068411         CDS       T02386                                 

Definition
(RefSeq) uncharacterized protein LOC101068411 isoform X3
  KO
K05461  KIT ligand
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101068411
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101068411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tru04052]
    101068411
Cytokines and growth factors [BR:tru04052]
 Growth factors
  Growth factors (RTK binding)
   101068411
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 101068411
NCBI-ProteinID: XP_011611710
Ensembl: ENSTRUG00000025114
LinkDB
Position
18
AA seq 227 aa
MTPITDDVSKLSSLKQNVPSDYEIPVSSIPKDVAGTCWVVLNIYPLEQSLRNLAGMFGAV
SSNREQISVFISMLKSLRFTFNHEELEAAMQLFQCHYRERGLMSGLYFDYIKDILHAASQ
GTSGLPCKPPPCLNQHPSPGGQEEGRGSSWSIRAPWILVLIPFTACAVILLWLGKSGRLS
PSCNVEDLRLRPFDMIPTVSISIPLQTLPNPADSEPVQDSVREHESS
NT seq 684 nt   +upstreamnt  +downstreamnt
atgacacccataactgatgatgtgagcaagctgtcctcactgaagcagaacgttccctcc
gattatgagattcccgtcagctccatccccaaagacgtggccggcacgtgctgggtggtc
ttaaacatataccctttggagcagagtcttcggaacctggccggcatgtttggcgccgtc
tcctccaacagagagcagatcagcgtcttcatatccatgctgaagagcctccgcttcacc
ttcaaccacgaggagctggaagcggcgatgcaactctttcagtgtcattatcgagagagg
ggcctgatgtccggtctttactttgactacatcaaagacatcctccacgccgcctctcaa
ggaacatccggcctcccgtgcaagcccccgccgtgccttaaccagcatccctctccaggg
ggtcaggaggagggtcgaggctccagctggtcgatcagagcgccctggattctggtactc
atcccttttacagcttgtgccgttatcctcctgtggctggggaagtctgggcggctctct
cccagctgcaacgttgaggaccttcgactgcggccttttgacatgatcccgaccgtttcc
atctccatcccgctccaaacgctccccaatcctgccgacagcgagccggtgcaggattcc
gtccgtgaacacgagagcagctga

DBGET integrated database retrieval system