KEGG   Takifugu rubripes (torafugu): 101068520
Entry
101068520         CDS       T02386                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00010  Glycolysis / Gluconeogenesis
tru00030  Pentose phosphate pathway
tru00051  Fructose and mannose metabolism
tru00052  Galactose metabolism
tru01100  Metabolic pathways
tru01200  Carbon metabolism
tru01230  Biosynthesis of amino acids
tru03018  RNA degradation
Module
tru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101068520
   00030 Pentose phosphate pathway
    101068520
   00051 Fructose and mannose metabolism
    101068520
   00052 Galactose metabolism
    101068520
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101068520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tru01009]
    101068520
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tru03019]
    101068520
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101068520
Protein phosphatases and associated proteins [BR:tru01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101068520
Messenger RNA biogenesis [BR:tru03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101068520
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 101068520
NCBI-ProteinID: XP_011620226
LinkDB
Position
3
AA seq 780 aa
MSTNQPTSMDPTKMGLGRSIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVYFVHEGYQGL
VDGGEHIRLATWESVSMMLQLGGTVIGSARCKDFRSREGRMTAACNLVKLGITNLCVIGG
DGSLTGANEFRTEWSGLLVDLVRAGRITEQEAKKSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTAQACGADWVFIPEMPPDHG
WEDHLCRRLTDQRARGSRLNVIIVAEGAMSRDSKPITSEQIKKLVTDRLGFDTRTTVLGH
VQRGGTPSAFDRILGSRMGVEAVMALLEATPDTPACVVSLSGNQAVRLPLMECVQVTKDV
TAAMAEGRFEDAVKLRGKSFENNWNTYKLLAHINPPDVKSNINVAIVNIGAPCAGMNAAV
RSAVRMGIIQGHNMLAVYDGFDGLAEGQIEPITWTSVSGWTGKGGSMLGTKRSLPGKMLE
KISQNISRFNVHALVIIGGFEAYVGGLELVQAREKYEEMCIPMVVIPATVSNNVPGSDFS
IGADTALNTITSTCDRIKQSAAGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIFEEK
FSIRDLESNVEHLVEKMKTTVKRGLILRNENSNANYTTDFIFNLYSEEGKGVFDCRKNVL
GHMQQGGTPTPFDRNFGTKMGAKSVLWLTDKLKECYRHGRIFANTPDSACVLGMRKRALM
FQPLAELKEDTDFEHRIPRTQWWLKIRPIMKILAKYDIKLDTTEHADIEHVIKKRGHLGQ
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgtccacaaaccagccgacatccatggaccccacaaaaatggggttgggacgctccatc
gccgtgctaacgtcgggaggggacgcccaaggcatgaacgctgctgttcgagccacagtc
agagtgggtctttacaccggagcgaaggtctacttcgttcatgagggctaccagggcctg
gtggatggaggggaacacatccgcctcgccacatgggagagtgtgtccatgatgcttcag
ctgggagggacggtcatcggcagcgctcgctgcaaggacttccgctccagggagggccgc
atgacagccgcatgcaacctagtaaagctgggcatcaccaacctgtgtgtgatcgggggt
gacggcagtctgaccggggccaatgagttcaggactgagtggagtgggctgctggttgac
ctcgtgcgagcaggcaggataactgaacaagaagcaaagaaatcttcccacctgaacatc
gtgggcatggtgggttccatcgacaacgacttctgcggcacggacatgaccatcggcacg
gactccgccctgcaccgcatcatcgaggtggtggacgccatcactactactgcacagagc
caccagaggacatttatcctggaggtgatgggcaggcactgtgggtacctggccctggtg
acagcccaggcctgcggagctgactgggtcttcatcccagagatgcccccagatcacgga
tgggaggaccacttgtgcaggaggctgacagaccaacgagcccgaggctcccgtctcaac
gtgatcatcgtggccgagggagccatgtccagagacagcaaaccaatcacgtccgaacag
atcaagaagctggtgaccgacaggctcggctttgacacccgcaccaccgttttgggacac
gtgcagaggggagggacgccgtcggcattcgacagaatcctgggcagcaggatgggcgtg
gaggccgtgatggccctgctagaggccacccctgacacccccgcctgcgtggtcagcctc
tctggaaatcaggctgtcaggctgccgctcatggagtgcgtccaagtgaccaaagacgtg
accgctgccatggctgaaggcagattcgaggatgccgtcaagctcaggggaaagagtttt
gagaacaactggaacacttacaagctgttggcccacatcaaccctccagatgttaaaagc
aacatcaacgtggccattgtgaacatcggtgccccctgcgccgggatgaacgccgcggtc
cgctcggccgtcaggatgggcatcatccagggtcacaacatgctggccgtttatgacggc
tttgatggcctggctgaaggacagatcgagcccatcacctggacttcagtcagtggctgg
accggaaaaggaggctccatgttgggcaccaaaagatctttgccaggaaaaatgttggag
aaaatcagccagaacatctctcggttcaacgtccacgcgctggtgatcatcgggggcttc
gaggcctacgtggggggtctggagctggttcaggccagagagaagtacgaagagatgtgc
attccaatggtggtcatccccgctaccgtctccaacaacgtccccggctctgacttcagc
atcggcgccgacacggccctcaacaccatcacctccacctgcgacaggatcaagcagtca
gcggcggggaccaagcgccgcgtgttcatcgtggagacgatgggaggctactgcggctac
ttggccaccatggccggcctggctgccggcgccgacgccgcctacatcttcgaggagaag
ttcagcattagagacctggagagcaacgtggagcatctggtcgagaagatgaagacgaca
gtgaagaggggtttgatcctcaggaatgaaaactctaacgccaactacaccactgacttc
attttcaacttgtattcggaggaaggcaagggtgttttcgactgccgtaagaacgttctg
ggccacatgcagcagggtggtactccaaccccttttgacaggaactttggcacaaaaatg
ggtgccaagtcggtattgtggctcacagataaactcaaggagtgctacagacacggtcgt
atctttgccaacaccccagactccgcctgcgtgctgggcatgaggaagagagcgctcatg
ttccagcctcttgccgagctgaaggaagacacagactttgagcaccgcatccccaggaca
cagtggtggctgaagatcaggcccatcatgaagatcctggccaagtacgacatcaagctc
gacaccacagaacatgcagacatagagcacgtgatcaagaagaggggccatcttggccag
tag

DBGET integrated database retrieval system