KEGG   Takifugu rubripes (torafugu): 101068520Help
Entry
101068520         CDS       T02386                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00010  Glycolysis / Gluconeogenesis
tru00030  Pentose phosphate pathway
tru00051  Fructose and mannose metabolism
tru00052  Galactose metabolism
tru01100  Metabolic pathways
tru01200  Carbon metabolism
tru01230  Biosynthesis of amino acids
tru03018  RNA degradation
Module
tru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101068520
   00030 Pentose phosphate pathway
    101068520
   00051 Fructose and mannose metabolism
    101068520
   00052 Galactose metabolism
    101068520
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101068520
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101068520
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101068520
Messenger RNA biogenesis [BR:tru03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101068520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101068520
NCBI-ProteinID: XP_011620226
LinkDB All DBs
Position
3
AA seq 780 aa AA seqDB search
MSTNQPTSMDPTKMGLGRSIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVYFVHEGYQGL
VDGGEHIRLATWESVSMMLQLGGTVIGSARCKDFRSREGRMTAACNLVKLGITNLCVIGG
DGSLTGANEFRTEWSGLLVDLVRAGRITEQEAKKSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTAQACGADWVFIPEMPPDHG
WEDHLCRRLTDQRARGSRLNVIIVAEGAMSRDGKPITSEQIKKLVTDRLGFDTRTTVLGH
VQRGGTPSAFDRILGSRMGVEAVMALLEATPDTPACVVSLSGNQAVRLPLMECVQVTKDV
TXCMAEGRFEDAVKLRGKSFENNWNTYKLLAHINPPDVKSNINVAIVNIGAPCAGMNAAV
RSAVRMGIIQGHNMLAVYDGFDGLAEGQIEPITWTSVSGWTGKGGSMLGTKRSLPGKMLE
KISQNISRFNVHALVIIGGFEAYVGGLELVQAREKYEEMCIPMVVIPATVSNNVPGSDFS
IGADTALNTITSTCDRIKQSAAGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIFEEK
FSIRDLESNVEHLVEKMKTTVKRGLILRNENSNANYTTDFIFNLYSEEGKGVFDCRKNVL
GHMQQGGTPTPFDRNFGTKMGAKSVLWLTDKLKECYRHGRIFANTPDSACVLGMRKRALM
FQPLAELKEDTDFEHRIPRTQWWLKIRPIMKILAKYDIKLDTTEHADIEHVIKKRGHLGQ
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaaaccagccgacatccatggaccccacaaaaatggggttgggacgctccatc
gccgtgctaacgtcgggaggggacgcccaaggcatgaacgctgctgttcgagccacagtc
agagtgggtctttacaccggagcgaaggtctacttcgttcatgagggctaccagggcctg
gtggatggaggggaacacatccgcctcgccacatgggagagtgtgtccatgatgcttcag
ctgggagggacggtcatcggcagcgctcgctgcaaggacttccgctccagggagggccgc
atgacagccgcatgcaacctagtaaagctgggcatcaccaacctgtgtgtgatcgggggt
gacggcagtctgaccggggccaatgagttcaggactgagtggagtgggctgctggttgac
ctcgtgcgagcaggcaggataactgaacaagaagcaaagaaatcttcccacctgaacatc
gtgggcatggtgggttccatcgacaacgacttctgcggcacggacatgaccatcggcacg
gactccgccctgcaccgcatcatcgaggtggtggacgccatcactactactgcacagagc
caccagaggacatttatcctggaggtgatgggcaggcactgtgggtacctggccctggtg
acagcccaggcctgcggagctgactgggtcttcatcccagagatgcccccagatcacgga
tgggaggaccacttgtgcaggaggctgacagaccaacgagcccgaggctcccgtctcaac
gtgatcatcgtggccgagggagccatgtccagagacggcaaaccaatcacgtccgaacag
atcaagaagctggtgaccgacaggctcggctttgacacccgcaccaccgttttgggacac
gtgcagaggggagggacgccgtcggcattcgacagaatcctgggcagcaggatgggcgtg
gaggccgtgatggccctgctagaggccacccctgacacccccgcctgcgtggtcagcctc
tctggaaatcaggctgtcaggctgccgctcatggagtgcgtccaagtgaccaaagacgtg
accngctgcatggctgaaggcagattcgaggatgccgtcaagctcaggggaaagagtttt
gagaacaactggaacacttacaagctgttggcccacatcaaccctccagatgttaaaagc
aacatcaacgtggccattgtgaacatcggtgccccctgcgccgggatgaacgccgcggtc
cgctcggccgtcaggatgggcatcatccagggtcacaacatgctggccgtttatgacggc
tttgatggcctggctgaaggacagatcgagcccatcacctggacttcagtcagtggctgg
accggaaaaggaggctccatgttgggcaccaaaagatctttgccaggaaaaatgttggag
aaaatcagccagaacatctctcggttcaacgtccacgcgctggtgatcatcgggggcttc
gaggcctacgtggggggtctggagctggttcaggccagagagaagtacgaagagatgtgc
attccaatggtggtcatccccgctaccgtctccaacaacgtccccggctctgacttcagc
atcggcgccgacacggccctcaacaccatcacctccacctgcgacaggatcaagcagtca
gcggcggggaccaagcgccgcgtgttcatcgtggagacgatgggaggctactgcggctac
ttggccaccatggccggcctggctgccggcgccgacgccgcctacatcttcgaggagaag
ttcagcattagagacctggagagcaacgtggagcatctggtcgagaagatgaagacgaca
gtgaagaggggtttgatcctcaggaatgaaaactctaacgccaactacaccactgacttc
attttcaacttgtattcggaggaaggcaagggtgttttcgactgccgtaagaacgttctg
ggccacatgcagcagggtggtactccaaccccttttgacaggaactttggcacaaaaatg
ggtgccaagtcggtattgtggctcacagataaactcaaggagtgctacagacacggtcgt
atctttgccaacaccccagactccgcctgcgtgctgggcatgaggaagagagcgctcatg
ttccagcctcttgccgagctgaaggaagacacagactttgagcaccgcatccccaggaca
cagtggtggctgaagatcaggcccatcatgaagatcctggccaagtacgacatcaagctc
gacaccacagaacatgcagacatagagcacgtgatcaagaagaggggccatcttggccag
tag

DBGET integrated database retrieval system