KEGG   Takifugu rubripes (torafugu): 101069597Help
Entry
101069597         CDS       T02386                                 

Definition
(RefSeq) uncharacterized protein LOC101069597
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101069597
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tru03036]
    101069597
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     101069597
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101069597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101069597
NCBI-ProteinID: XP_011602554
LinkDB All DBs
Position
5
AA seq 1956 aa AA seqDB search
MEGCSRMSVKELCETDDLATSLVLDPLLGFSTHKMNISPPPEVRRWGNLKETLLRFQRTH
DFGAAFEALTEGELAGDYFNALGNHRQELLRQHVHRYLSAFLLDSGIKIESCDRYSSETN
GAKITSTRHWFAGERVEVLLGCIAELSPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFLPGEKNIACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFRHRGKQPECEETKDPVGQKYRLRERYLRHQREKGHFPVRPAAPGNHSGIFKAIPSRN
SFTQQMRRNALKNRKLRQSTTWRREKRRRSGKQPLKPSTVKPHQGVPLLSQVALKDLRIR
VRRHSLDFLLGCKDPTSKERAILLQLEEVKAGNRPQPLALKPSMSTHQKSRPASKSTGRP
VKVVERRLLHLRTSTRAKRRSENTPTPQTELNNNPKSGALCLPVQMETPLEKSEKTGKAS
ETERTQNPETQTTVQDGIKGSSPTEDSRSTSKKAVDNPLKSLKQYLRVSLTRLSLPTTGE
TDRSCKDRLRRSSNSLRPAASAPPSLRASRSQQRPAAGPHQGRGGGETAVDRSNLRRRPL
SECGDGLLQRERREKEEEAPSGPQTGTEEQDNPDGQRGKAKAAPALMESQANAAAEEPLC
KVKPSESQRGRRNPERAASSKGGGAKQAEEVTKRVNQQPARRCREDIVIKQAKVLLSDIL
RSDESAMVNGLYRRLVGSSSASSSWEAQSAEEEAQTEIDGGRNRCSVQGRLLRHGRTRPR
AAKTKPEGQQSVKGPSGQQSPAAVATEPCRDAAQLSQSQHRLDAPPAALLNSLPHDPPTS
ARAKTGPQPDATLQAHIQSNIPLKKRTFRSSVEIDLEPGLTGASGPTCRGDTEESPSVKL
KPQAGPEEGNHPQKNGKVRRRRTELQRLTTKKVLAVYRGLRPRNNEQRCVLRNAQKCKSE
GREAAESQAQLADGDQPSEEKTGQEVAGVPNPCCEAPNPHESQLKGEAKTLVGLDESKPS
VGLKILFKRRRGKVWQMQGTAFDKVALKMEKPEELVACDPFKAIMESVSVLNMEMEAARA
HVHASRKSNNRLRRLKRRGERLRKAKSLPSGKVLGALERLDSLDRERRGRVKPVPEKREK
GSEGSPSAGQETKSEDCFAKSCCMFESGSQQKVQPEADPNGLSLPVMKLRRKMEDIWEVE
ADARKEAKGHVLGKQRGCFDLAKLKEECPSVQRPNSNNLFKPEPPPFSLSLSPLSLSSPL
SDSRSDVTSLAADTVPERPEMNSGGRKPRHGVERTRRSGPVEAPTPCLSHSLQQIDNSLS
RLSEGLCSSQILEKPHACPVVSTSVIQPPSQSPPFAAADSMLSGEPAFPNCCDDILDFQC
LNFEGYYQPQNMLPSSPSDLCSLDPPTDPFSSPLSHSPSDTWATETPYLGPPSPGNNFVG
EDLQFFPNLISSRNDCVPLDCETKDASKDRTSPHPGFSFSALGDSDAAAKERLIGKNLGV
RHSRDDPKAQPLPAASKPRIFGASQTPVSLSQPAAFSVRASTSQPRVQSSLRNQGPFHRV
ALPSRSQLFGTSQSNCVRGASQSCFPRSVPSSQTSNRFIAPSLFSLRNPNPPESPRVQTS
SVIHRVLRFQEGNPIQNLDSAPCKDATAAGGPTLTPRTMGTKAGAGERTQLNAKPGLLSD
SHHGGNISLQGFCKDPGHLAPASRPSTYFNKPGSSFPPPFSKSRMSSEKPNAVEANPAYK
PPPGLPRSCFPNKISEVYPAPQQNKLDKHQPCYAHQDPFDFSFGSSLPHMSQDNSPHVHH
SSPPGTAASKGQPPLASASFPYGYQGPPYVLNFSGDHSLTLGLRDGAEGCPGLGSANYTY
HCLMEPSGTQGRLVLEPCGPQLSAPTSFSLGGFSGLKGQDEHGRKDMQPQFQHREHHGPP
HYGPAATSHSMGSTKPKRVRLVVTDGTVDLDLQYSD
NT seq 5871 nt NT seq  +upstreamnt  +downstreamnt
atggaaggatgcagtagaatgagcgtgaaggagctgtgtgagaccgatgacctggccacc
agtttggtcctggaccctcttctgggcttcagcacccacaaaatgaacatcagtcctccg
ccggaggtccggcgctggggcaacctcaaagagaccctgctgcgctttcagcgcacgcac
gacttcggcgccgcgtttgaggcgctgacagagggcgaactggccggggactactttaac
gccctggggaaccaccgccaggagctcctgaggcaacatgtccaccgctacctcagtgcc
ttcttgttggatagcggcatcaagatagagtcctgtgacagatactcctccgagaccaac
ggcgcaaagataacatcaacacgacactggtttgcaggggagcgggtggaggtcctgctg
ggctgcatcgcggagctgagtccagctgacagcgcggtgctgagggcaggagtcaacgac
ttcagcgtgatgtattccacccgtaaacgctgcgctcagctctggctcggccccgcggcg
tttatcaaccacgactgcaaaccaaattgcaagttcctccctggtgagaagaacatcgct
tgtgtggaggtgattcgacccatctcacctggggaggagatcacctgttactatggtgcc
agttttttcggagaagggaatgaaatgtgtgaatgctgcacctgcgagaggaacggcgag
ggccacttcaggcaccgggggaagcagcctgaatgtgaggaaacaaaagaccccgtgggc
caaaagtaccgactgagggagcgatacctgcggcatcagagagagaagggtcactttcct
gtcaggccagcagcaccagggaatcactcaggaatctttaaagccatcccgtcaaggaat
tccttcacccagcagatgaggaggaacgccttgaagaacagaaagctcagacagtcgacg
acgtggaggcgagagaagcgcaggcgatcaggcaaacagccgctgaaaccctccacggtg
aaacctcatcagggagttccgcttctgtcccaagttgctctgaaggacctcagaatcaga
gtacggcgccactcgctggacttcttgcttggctgcaaggacccgacaagcaaagaaagg
gccattcttctacagctggaggaggtaaaagcaggaaataggccgcagcctttggcttta
aaaccctcgatgtcgactcatcagaaaagcagacctgcttcgaagagcacaggcaggccc
gtcaaggtcgtcgaaaggaggttgcttcacttaaggacttctacaagagccaaaaggaga
agtgaaaacacacccacccctcaaacagagttaaacaacaaccctaaaagtggagctttg
tgtctccctgtccaaatggagacgccgttggaaaagtcggagaaaacgggcaaagcctca
gaaaccgaaaggactcaaaacccagaaactcagacaactgtgcaagatggtatcaaaggt
tcgtccccaacagaggacagccggagtacatctaagaaagctgtggacaatcccctcaag
tcgctgaagcaatacctcagagtcagtctaacacggttatcgctgcccacaactggagag
acggacaggagctgcaaggacaggctcaggagaagcagcaacagcctgagacctgcagcc
tcagcgcctccctcactcagagcatccaggtcgcagcagaggccggcggcaggtccgcac
caaggcagaggagggggagaaacggccgtagacagaagcaacctgaggaggcgaccgctg
agtgagtgtggagacggtttgctgcagagagagagaagggaaaaggaggaggaggctccg
tcagggccacaaaccggcacagaggagcaggacaaccctgatgggcagagaggaaaagca
aaagccgcacctgcattgatggaatctcaagctaacgcagccgctgaagagccgctgtgc
aaagtgaagcccagtgaaagtcagagaggacggaggaacccggagcgtgccgcgagtagt
aaaggaggaggcgccaaacaagcggaggaggtgactaagagggtgaatcagcagccagcg
aggaggtgcagagaagatatcgtcataaagcaggcaaaggttctgctctcggatattctg
aggagcgatgagtccgccatggttaacggactgtaccgacggcttgtaggaagctcttct
gcctcctcttcatgggaggcgcagagtgctgaggaggaagcgcaaactgaaatagacgga
ggcaggaaccggtgctcggtgcaggggaggcttctgagacacgggcggaccagaccaagg
gcagctaaaacaaaaccagaaggtcagcagtctgtcaagggaccttcgggccaacagagt
cccgccgcggtggcgacggagccgtgtcgggacgccgcgcagctctcgcaatcacagcac
aggcttgacgcccccccagctgccctcctcaactcgctacctcatgacccgccgacgtca
gcgagggccaaaaccggcccgcagccagacgccaccctgcaggcgcacatccagtccaac
atccccctgaagaaacgcacatttcgcagctctgtggaaatcgacttggagccaggtctg
accggagcctcgggtccgacctgcagaggggacactgaggagagtccgtccgtgaagctg
aagccacaggccggtccagaagagggcaatcacccccaaaaaaacggtaaagtccgacgg
aggaggacagaattgcagaggttgaccactaaaaaggttctggccgtttacagaggcctc
cgaccccgaaacaatgagcaaaggtgtgtgttaagaaatgctcagaagtgtaaatcggag
gggcgagaagcagctgaaagccaggctcagctggccgacggcgaccagcccagcgaggag
aagacgggtcaagaggtcgccggcgttcccaatccgtgttgcgaagctccaaacccgcac
gagtctcagctgaaaggcgaggcaaaaacgctcgttgggctggatgagagcaagccgagc
gtcgggttgaagatcctttttaagaggaggagggggaaggtgtggcagatgcaaggcacc
gcctttgacaaagtggccttaaaaatggagaagccagaagagctggtggcttgtgatcca
ttcaaagccatcatggagtctgtgtccgtcttgaatatggaaatggaggcggctcgggct
cacgtgcacgccagtagaaagtcaaataataggttgcggcggttaaaaagaagaggcgag
aggctcaggaaggccaagagtctcccttccgggaaagttctcggagctttggagagactc
gacagtttggatcgggagcgacgcggcagggttaagccggtgccggaaaagagggagaag
ggcagcgaggggtcgccgagcgcagggcaagaaacaaaaagtgaagattgcttcgccaag
agctgctgcatgtttgaaagtgggtcacagcagaaagtgcagcccgaagcagatccgaac
ggcctttcgcttccggttatgaagctgcgcagaaagatggaggatatctgggaagtggag
gccgacgccaggaaagaggcgaagggccacgtgttggggaagcagaggggctgttttgac
ctggccaaactgaaggaggagtgcccgtctgtgcagaggcccaacagcaacaacctcttc
aaaccggagccgccgccattttccttatccctctcgccgctgtccctgtcttcccctctc
agcgacagcaggagcgacgttacgtcactggctgcggatacagtcccagaaaggccagag
atgaacagcggaggaaggaaaccgaggcacggcgtggagagaacgcgccggtccgggccc
gtggaagcgcccaccccctgtctcagccatagcctgcagcagattgacaacagcctctcc
aggctctccgagggactgtgctcgtctcagattttagagaagccgcacgcctgtcccgtt
gtctccacttcagtcatccagccgccgtcccagtcccccccgttcgcggccgccgacagc
atgctctccggggagcccgcttttccaaactgctgcgacgacatcctggactttcagtgc
ctcaactttgagggttattaccagcctcagaacatgcttccctcgtccccctcagatctg
tgttccctggatccgcccaccgatcctttcagcagccccctctcacacagcccgtcggac
acgtgggccacagaaacgccgtacctcggtccccccagcccgggaaataactttgtgggc
gaggatctgcagttcttccccaacctgatttcttccaggaatgactgtgttcctctggac
tgtgagacaaaggacgcttccaaagaccggacgtccccccaccccggtttcagtttttct
gctcttggagattccgacgcggccgccaaagagcggctcatcggtaagaatctaggagtg
aggcattccagggatgatcccaaagctcagcccctgcccgctgccagcaagcctcgcata
tttggtgcttcccagacccccgtttctttgtcccaaccggcagccttcagtgtcagggcg
agcaccagccagcctagagtccagtccagcctcagaaaccagggcccgttccaccgcgtg
gcccttcccagccgatcccagttgttcggaaccagtcagtcaaactgtgtcagaggggcg
tcccagagctgttttcctagatccgtcccatcctctcaaacctcgaaccgattcatcgct
ccttctcttttctccctgaggaacccgaatcctcccgagagcccgagagttcagacctca
tcggttatccacagggtgctcaggttccaggaggggaaccccatccagaacctggacagt
gcgccctgtaaggacgccacggctgctggcggcccgacgctcacgcccagaacgatggga
acaaaagctggtgctggtgaaaggacgcagctcaacgccaaacccggtttgctgtcagac
agccaccacggaggcaacatctccctccagggcttttgcaaggacccgggtcacctggct
ccggccagcaggcccagcacgtacttcaacaaacccggctcctccttccctcccccgttc
agtaagagcaggatgtcttcggaaaaacccaacgccgtggaagccaacccggcgtacaaa
ccccccccggggctgcccagatcctgcttcccaaacaaaatatcggaggtttatccggcg
ccgcagcagaacaaactggacaaacaccagccctgttacgctcatcaagacccgttcgat
ttcagcttcggctcgtccctgccgcacatgtctcaggacaacagcccccacgtccaccac
agctcgcctcccggcacagcagcgagcaagggccagccccccctcgcctcggcctccttc
ccttatggctatcaggggcctccttatgtgctcaacttcagcggagaccactcgctcacc
ctgggcctcagagacggcgccgaggggtgccccggtttaggatcggcaaactacacctac
cactgcctgatggagccgtcggggacgcaggggcggctggttctggagccctgcggcccc
cagctctctgccccgacgtccttctccttggggggattctcggggctcaaaggccaggac
gaacacggcaggaaggacatgcagccacagttccagcacagggagcaccacggcccgccg
cactacgggcctgccgccacctcccactccatgggttctaccaagcccaagagggtgagg
ttggtggtgacggacggcaccgtggacctggacctccagtactcggactga

DBGET integrated database retrieval system