KEGG   Takifugu rubripes (torafugu): 101069645
Entry
101069645         CDS       T02386                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04210  Apoptosis
tru04620  Toll-like receptor signaling pathway
tru04621  NOD-like receptor signaling pathway
tru04622  RIG-I-like receptor signaling pathway
tru04623  Cytosolic DNA-sensing pathway
tru04625  C-type lectin receptor signaling pathway
tru04920  Adipocytokine signaling pathway
tru05132  Salmonella infection
tru05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101069645
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101069645
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101069645
   04621 NOD-like receptor signaling pathway
    101069645
   04622 RIG-I-like receptor signaling pathway
    101069645
   04623 Cytosolic DNA-sensing pathway
    101069645
   04625 C-type lectin receptor signaling pathway
    101069645
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101069645
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101069645
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101069645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101069645
Protein kinases [BR:tru01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101069645
SSDB
Motif
Pfam: NEMO CC2-LZ HALZ
Other DBs
NCBI-GeneID: 101069645
NCBI-ProteinID: XP_029683734
Ensembl: ENSTRUG00000002414
LinkDB
Position
20
AA seq 565 aa
MVQPQPEGPMQWDMSADESGGVLRVPPELAANEVFTRLLSDNQQLRETLRRSNLALRQRC
EEMEGWQRRSREDREFLSCRFQEARALVERLAEENHSLRGVVNGPASSSPPSSQAEDLQG
PPPPKGPVDGAQTLEQRDGTRLEEADQCTQTTPPRSLVRTTREGPPGQPVEGANDFLQLL
KSHKEKLEEGMRDLRRKNEEVERERDESEKERERMRRCIEQLWSKLAQAQVRAAQTTGAA
EEAVQQRSEAQHSSDCSSLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTETLLKQK
EKDCAQLAKDCEALKAQATSLLGELNERQSCLEKSEHERKLLEEKLCSKTKALQGAEREL
EQQRKQHHVAMDELLLQSQNLEQALKTERHVVTEEKKKLTQLQHAYTCLFKDYDSKLKNE
LQGGDLCSRLEEAERALALKQDLIDKLKEEVERQKGSLETVPVLTAQAEIYKADFLAERE
AREKLNQKKEELQEQLTQALADIDRLKQEATSRACMEQMKLRHREEFTPRPPHIPPPQGM
FPGGPPFNTVPPRLLVSYSRSGAGR
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggtgcagccacagcccgagggtccgatgcagtgggacatgtcagcagacgagagcggg
ggggtgctcagagtccccccggagctggcagccaatgaagtgttcacacggttgctgagt
gacaaccagcagcttcgagagacgctgaggaggagcaacctggcgctgcggcagcgctgc
gaggagatggaggggtggcagcgccggagccgcgaggaccgcgagttcctcagctgccgc
ttccaggaggccagggctctggtggagaggctggcagaggagaatcactccctgcggggc
gtcgtcaatggacccgcgtcctcctcgcccccctccagccaagcagaagacctgcagggc
cccccacccccaaagggacccgtggatggagcgcagacgctggagcagagggacgggacc
aggctggaggaggcagatcagtgcacgcagaccacgcccccccgcagtttggtaagaacg
actcgtgaggggccacctggccagcctgtagagggcgccaacgacttcctccagctgctg
aagagccacaaagagaagctggaggaaggaatgagagacctccggaggaagaatgaagag
gtggagagagagagggatgaaagcgagaaggagagagagaggatgaggcgctgcatcgag
cagttatggagcaaactggcccaggcacaggtgagagcagcacagaccactggtgcagct
gaagaggctgttcagcagcgttcggaggcccaacactcctctgactgctccagcttggcc
aaactaacagagcagcttcaggccacacagggcaggtatcgtgagctggaggagaagcta
gattacctgcagaagagttcagctcagcgggacagaactgaaactctgctcaagcagaag
gagaaggactgcgctcagctggccaaagactgtgaggctctgaaagctcaggcaacatct
ctgttaggggagctgaacgagcgccagagctgcctggagaaaagtgaacatgaacgtaaa
ctgctggaggaaaagctctgcagtaagactaaagccctgcagggggcagagcgcgagctg
gagcagcagaggaagcagcatcatgtggccatggacgagctgctgctgcagagccagaac
ctggagcaggccctgaagaccgagagacacgtggtgaccgaggagaagaagaagctgact
cagctgcagcacgcctacacctgtctgttcaaagattatgattccaaactgaagaacgag
ctacaggggggggatctgtgcagccgcctggaggaggcagagagggctctggccctgaaa
caggacctgatcgataagctgaaggaggaggtggagcggcagaagggatccctggagacc
gttcctgtcctcactgcacaggctgagatctataaagcagatttcctggcagagagggaa
gcccgagagaagctgaaccagaagaaggaggagcttcaggagcagctgacccaggcgctg
gcggacatcgacaggctgaagcaggaagccacctcacgagcttgtatggagcaaatgaag
ctgaggcaccgggaagagttcacgccgagacccccccacatcccccctccccaagggatg
ttccctggtggtccgcccttcaacacggtgcccccccgcctcctcgtttcgtactcaagg
tctggggccggtcggtga

DBGET integrated database retrieval system