KEGG   Takifugu rubripes (torafugu): 101069887Help
Entry
101069887         CDS       T02386                                 

Gene name
gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00350  Tyrosine metabolism
tru01100  Metabolic pathways
Module
tru_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101069887 (gstz1)
Enzymes [BR:tru01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     101069887 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 101069887
NCBI-ProteinID: XP_003962685
LinkDB All DBs
Position
2
AA seq 220 aa AA seqDB search
MHLSLVQLAKPVLHGYFRSSCSWRVRIAFALKGVEFDQVAVNLIKDGGQQLTEQYKTLNP
MQQVPAVEIDGITLSQSLAVIQYIDETRPGPRLLPADPKKRAQVRLISDLIASGIQPLQN
LYVIQKMGAEKMQWAQHFIDRGFQALEPILKETSGTYCVDDEISMADICLVPQVYNAERF
KVDLEKYPTIKRLNQTLREIEAFRVSHPSCQPDTPEELRG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgtcccttgttcaactcgccaagcctgttcttcatggatacttcagaagctcc
tgctcctggagagttcggatcgcctttgctcttaaaggtgttgaatttgaccaggttgca
gttaatctaatcaaagatggaggtcagcagctgacagagcagtacaagacattaaaccct
atgcaacaggtgcctgcagtagaaatcgatggcatcactctgtctcagtcattggcagtg
atccagtacatcgacgagacgcgtccgggacctcgtcttctcccagcagacccaaagaaa
cgcgctcaggttcggctgataagtgacctcattgcctcaggaattcagccgctgcagaat
ttgtacgtgattcagaagatgggagcggaaaagatgcagtgggcccagcatttcatcgat
cgcggcttccaagctctggagcctattctgaaggaaacatcagggacgtactgtgtggat
gatgagatctccatggcagacatctgcctggtcccacaggtctacaatgcagagaggttc
aaagtggacctggagaagtatcccaccatcaaacggttgaatcaaaccctacgtgagatc
gaagcctttagagtgagccacccgtcctgccaaccggacacgcctgaagagctgcgtggt
tag

DBGET integrated database retrieval system