KEGG   Takifugu rubripes (torafugu): 101069995
Entry
101069995         CDS       T02386                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101069995
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101069995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tru04052]
    101069995
   00536 Glycosaminoglycan binding proteins [BR:tru00536]
    101069995
Cytokines and growth factors [BR:tru04052]
 Growth factors
  Growth factors (RTK binding)
   101069995
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101069995
SSDB
Motif
Pfam: FGF PilX_N
Other DBs
NCBI-GeneID: 101069995
NCBI-ProteinID: XP_003970487
LinkDB
Position
14
AA seq 156 aa
MADDGAAAFDVQAVGGGFPRDYRRLTQLYCMNGGHHLQILPDGTVQGLRDDGDAHTVLKL
KAVDRGVVVIRGTEAARYLAMNDQGRLYGSPTVTDECYFLEKLEENHYNTYMSRQYQDRN
WYVALKKNGKPKLGPRTHVGQKAVFFLPRQLQDSSE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcggatgacggcgcggctgcattcgatgttcaggctgtaggtggcggtttcccgcga
gactaccggcgtctgacgcagctgtactgcatgaacggcgggcaccacctccagatcctg
cccgacgggacggtgcagggcctgcgggacgacggggacgcacacactgttttaaagctt
aaagctgttgacaggggtgtcgtggtcatcagaggcacggaggccgctcggtatttggcc
atgaacgaccaaggacgactgtacggctcgcccacggtgacagacgagtgttacttcttg
gagaagctggaggagaaccactataacacctatatgtcccgccaataccaggacaggaac
tggtacgtggccctgaaaaagaacggtaaacctaagctggggcccaggactcatgtggga
cagaaggccgtcttcttcctgccccgacagctgcaggacagcagcgagtga

DBGET integrated database retrieval system