KEGG   Takifugu rubripes (torafugu): 101070322Help
Entry
101070322         CDS       T02386                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00250  Alanine, aspartate and glutamate metabolism
tru00410  beta-Alanine metabolism
tru00430  Taurine and hypotaurine metabolism
tru00650  Butanoate metabolism
tru01100  Metabolic pathways
Module
tru_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101070322
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101070322
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101070322
   00430 Taurine and hypotaurine metabolism
    101070322
Enzymes [BR:tru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101070322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 101070322
NCBI-ProteinID: XP_003975902
LinkDB All DBs
Position
22
AA seq 583 aa AA seqDB search
MATSEPRATDAEQDPNSDTLRPPSSTYEYAWMHGCTRKLGMKICGFLQKNNSLDDKGRLA
GQKNMLACNNSERDARFRRTETDFSNLFARDLLPAKNGEEPTIQFLLEMVDILTNYIKKT
FDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFFNQL
SSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREMIGWPNGEGDGLFSPG
GAISNMYSVMIARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTENVILL
STDERGRVIPADLEAKIIDAKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLH
VDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMC
AGYLFQQDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLY
NKIKNREGYEMVFDGVPQHTNVCFWYIPPGLRGMPDGDERREKLHRVAPKIKAMMMESGT
TMVGYQPQANKVNFFRMVVSNPAATQSDIDFLIDEIERIGHDL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggccacctctgagcccagagccaccgacgcggagcaggaccccaactccgacacttta
agacctccgtcctcaacttacgaatacgcgtggatgcacggatgcacacgaaaactggga
atgaagatctgtgggttcctgcagaagaataacagcctggatgacaaggggaggctggcg
ggccagaaaaacatgctggcgtgcaacaacagcgagcgggacgcgcgcttccggcgcacc
gagaccgacttctccaacctgttcgccagagacctgctgccagccaaaaacggagaggag
cccaccatccagtttttactggagatggtcgacatcctcaccaactacatcaagaagact
ttcgaccgttccaccaaagtcctggatttccaccaccctcatcagctcctggagggcatg
gagggcttcaacctggagctgtctgaccagcctgagtccctggagcagatcctggtggac
tgcagggacacgctcaagtacggcgtccggacaggtcacccgcggttcttcaaccagctg
tcttctggcctggacatcatcggcctggctggagagtggctaacatccacagctaacacc
aacatgttcacctatgaaatcgcccccgtcttcgtgctgatggaacaactgactctgaag
aaaatgagagagatgattggttggcccaacggagagggagatggactcttctcaccaggg
ggcgctatttccaacatgtacagcgtgatgattgcgcgttacaagtatttcccagaggtc
aagaccaagggcatgtctgcagctcctcgcctcgtcctcttcacgtctgaacatagccac
tattccataaagaaggccggagctgctctgggcttcggtactgagaacgtgatcctgctg
agcacagacgagagagggagggtcatccctgcagacctggaggccaaaatcattgacgcc
aagcaaaaaggttacgtgcccctctttgtgaacgccaccgccggttccacggtctacggc
gcgtttgaccccatcaacgagattgccgacatctgcgagaaatacaacctgtggctgcat
gtggatggagcgtggggcggcggacttctgatgtccaggaagcatcgccataagctgaac
ggcgtggaaagggccaactcggtcacatggaacccccacaagatgatgggtgttcctctg
cagtgttccgccatcctggtcagagagaagggcatcctggcaggctgtaactccatgtgc
gctggttacctcttccaacaagacaaacagtacgacgtcacctatgacaccggcgacaag
gccatccagtgcggccgacacgtcgacatctttaagttctggctcatgtggaaggccaag
ggcaccatcgggtttgagcagcacatcgacaagtgtttggatctctctcagtacctctat
aacaagatcaagaacagggagggatatgagatggtgtttgacggagtgcctcagcacacc
aacgtctgtttctggtacatcccacccggcctgagaggcatgcctgacggcgatgagcgg
cgggaaaaactccacagggtggcaccaaagatcaaggccatgatgatggaatcagggacc
accatggtgggctaccagccacaggccaataaggtcaacttcttccgtatggtcgtctcc
aacccggcagccacccagtccgacatcgacttcctcatcgacgagatagagaggatcggc
cacgacctgtag

DBGET integrated database retrieval system